KEGG   Klebsiella pneumoniae 342: KPK_3181Help
Entry
KPK_3181          CDS       T00772                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01130  Biosynthesis of antibiotics
kpe01230  Biosynthesis of amino acids
Module
kpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPK_3181 (trpC)
Enzymes [BR:kpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KPK_3181 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     KPK_3181 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACI09876
UniProt: B5XS33
Position
3235132..3236490
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEVVPTQRNFYDALAGTRTAFILECKKASPS
KGLIREDFDPAAIASIYKHYASAISVLCDEKYFQGSFDFLPIVSKVAPQPILCKDFTIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLNMGVLTEVSNEEELERAIALKAKV
VGINNRDLRDMSIDLNRTRQLAARLGPDVTVISESGIHTYAEVRELSHFANGFLIGSALM
EQADLEAAVKRVLLGENKVCGLTRPQDAQVAWESCAIYGGLIFVPTSPRAVNDAQAKAVI
AAAPLQYVGVFRNAPLDEVVARAQALGLAAVQLHGDEDQAYIDALRDALADNVRIWKALS
VGETLPARTLRHVDKYLFDNGQGGSGQRFDWSLLQGQDLRNVMLAGGLGADNCVEAAKSG
CAGLDFNSGVESQPGIKDASKLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgttttagcaaaaatcgttgccgacaaagcgatttgggtagaagcccgcaaa
caacaacaaccgttagccagttttcagaatgaggtcgttccgacgcagcgcaatttctat
gacgcgctggccggcacccgcaccgcgtttattctcgagtgcaaaaaggcctcgccgtcg
aaggggttgattcgcgaagatttcgatccggcggcgatcgccagcatctacaaacactac
gcctcggcgatctcagtgctgtgtgatgagaaatatttccagggcagtttcgattttctg
ccgatcgtcagcaaggtcgcgccgcagccgatcctgtgtaaggacttcaccatcgaccct
taccagatctacctggcgcgctactatcaggccgatgcctgcctgctgatgctctcggtg
ctcgacgatgagcagtaccgccagctctccgcggtggcgcacagcctgaatatgggtgtg
ctgaccgaagtcagcaatgaagaggagctggagcgcgccatcgccctgaaggcgaaggtg
gtgggcattaacaaccgcgacctgcgcgatatgtcgattgaccttaaccgcacccgtcag
ctggcggcgcgtctcggcccggatgtcacggtgatcagcgaatccggcatccatacctat
gctgaagtgcgcgagctgagccacttcgccaacggcttcctgatcggctccgccctgatg
gaacaggcggatctggaagcggcggttaaacgcgtgctgctcggcgagaacaaagtgtgc
ggcctgacgcgcccgcaggatgcccaggtggcctgggagtcctgcgccatctacggtggc
ctgattttcgtcccgacttcgccgcgggcggtgaatgacgcccaggccaaagcggtgatc
gccgctgcgccgctgcagtacgtcggcgtgtttcgcaatgcgccgctggacgaggtggtc
gcccgcgcgcaggctctggggctggccgccgtgcagctgcacggtgatgaggaccaggcc
tatatcgacgcgctgcgcgacgccctcgcggacaacgtccgtatctggaaagcgctgagc
gttggtgaaaccctcccggcccgtacgctccgccatgtcgacaagtacctgttcgacaac
ggccagggcggcagcggccagcgctttgactggagcctgctgcagggccaggatctgcgc
aacgtcatgctggcgggtggcctgggtgccgataactgtgtggaagcggccaaaagcggc
tgtgccggactcgatttcaattcaggcgtagagtcgcaacccgggattaaagacgccagc
aaactggcctccgtattccagacgctgcgcgcatattaa

DBGET integrated database retrieval system