KEGG   Klebsiella pneumoniae 342: KPK_3182Help
Entry
KPK_3182          CDS       T00772                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPK_3182 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPK_3182 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPK_3182 (trpB)
Enzymes [BR:kpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KPK_3182 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3236500..3237693
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDETNVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTADGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRADYVSITDDEALDAFKALSRHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttactgaacccctacttcggcgaattcggcggcatgtatgtgccgcagatc
ctgatgcccgccctgcgccagctggaagaagcctttgtcagcgcgcagaaggacccggcc
tttcaggcggaattcactgacctgctgaaaaactacgccggacgtccgacggccctgacc
aaatgccggaatctgaccgaaggtacccgcaccaccctgtacctgaaacgcgaagatctg
ctgcacggcggcgcgcacaaaaccaaccaggtgctgggccaggccctgctggccaaacgg
atgggtaaaaccgaaattatcgccgagaccggcgccggtcagcacggggtcgcctcagcg
ctggccagcgccctgctcggcctgaaatgccgtatctacatgggcgccaaggacgtcgag
cgccagtcgccgaacgtcttccgtatgcgcctgatgggtgccgaggtgatcccggtgcac
agcggctccgccacgctgaaagatgcctgtaatgaggcgctgcgcgactggtctggtagc
tacgagaaggcgcactatatgctgggcaccgccgccggtccgcatccgttcccgaccatt
gtacgtgaattccagcgcatgattggcgaagagaccaaagcgcagatcctcgaaaaagag
ggacgtctgccggacgcggtgatcgcctgcgttggcggtgggtcaaacgccatcggcatg
tttgccgactttattgatgaaaccaacgtcggcctgatcggcgtggaaccggccgggcac
ggtatcgaaagcggcgagcacggcgcgccgctgaagcatggccgcgtggggatctacttc
ggtatgaagtcgccgatgatgcaaaccgccgacggccagatcgaagagtcttactccatt
tccgccgggctggacttcccgtccgttgggccgcagcacgcgtttctgaacagcaccggt
cgcgctgactatgtgtcgatcaccgacgacgaagcgctggatgcgtttaaagcgctctcc
cgccacgaagggattatcccggcgctggagtcctctcacgccctggcccacgcgctgaag
atgatgcgcgagaacccggaaaaagagcagctgctggtggttaacctctccggtcgcggc
gacaaagacattttcaccgtacatgacatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system