KEGG   Klebsiella pneumoniae 342: KPK_3183Help
Entry
KPK_3183          CDS       T00772                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPK_3183 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPK_3183 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPK_3183 (trpA)
Enzymes [BR:kpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KPK_3183 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3237693..3238502
Genome map
AA seq 269 aa AA seqDB search
MERYETLFAQLKNRQEGAFVPFVTLGDPGPEQSLKIIDALIEGGADALELGIPFSDPLAD
GPTIQGAALRAFAAGVTPAQCFEMLAAIRQKHPTIPIGLLMYANLVFSPGIDAFYAQCAR
VGVDSVLVADVPVEESAPFRQAAMRHNIAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLVEKLAEYHAAPPLQGFGISAPEQVSAAIDAGAAGAISGSAIVKI
IERHLDEPQTMLDELKAFVQSLKAATKTA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgagacgctgtttgcccaactgaaaaatcgccaggaaggcgccttcgtt
ccctttgtcaccctcggcgatccgggaccggagcagtcgctcaaaattatcgatgcgctg
atcgaaggcggcgccgatgcccttgagctggggatccctttctccgacccgctggcggac
ggcccgaccatccagggcgcggccctgcgcgccttcgccgcgggagtgaccccggcgcag
tgctttgagatgctggcggcgatccgccagaagcatccgaccatcccaatcggcctgctg
atgtacgccaacctcgtcttcagcccgggcatcgatgcgttctatgcccagtgcgcccgc
gtcggcgtcgactcggtgctggtagccgacgtgccggtggaagagtccgccccgttccgc
caggcggcgatgcgccataatatcgcgccgattttcatctgcccgcccaatgcggatgac
gatttactgcgccagattgcctcttatggccgcggctacacctatctgctgtcgcgcgcc
ggggtgaccggtgcggaaaatcgcgccgcgctgccgctgcaccacctggtggagaagctg
gcggaatatcacgccgcgccgccgctgcagggctttggtatctccgcgccggagcaggtg
agcgccgccattgacgccggagccgccggggctatctccggttccgccatcgtcaaaatc
atcgaacgccacctcgatgagccgcagaccatgctcgacgaactgaaagccttcgtccag
agcctgaaggcggcgaccaaaaccgcctga

DBGET integrated database retrieval system