KEGG   Klebsiella pneumoniae 342: KPK_3242Help
Entry
KPK_3242          CDS       T00772                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:kpe00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3296964..3297605
Genome map
AA seq 213 aa AA seqDB search
MAHRALLLVDLQNDFCAGGALAVPEGDSTVEVANALIDWSLARGEPIVASQDWHPADHGS
FASQHQVAPYTQGELDGLAQTFWPDHCVQHSEGAALHPLLKQQAINAVFHKGQNRVIDSY
SAFFDNGHRQKTELDGWLRGQGIVELTVLGLATDYCVKFTVLDALALGYMVNVIIDGCRG
VNLQPQDSSQAFMEMAAAGATLYTLDDWRESQA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcgagcgctgttactggttgatttgcagaacgacttttgcgccggcggcgcg
ctggcggttcctgaaggcgacagtaccgtcgaggtggctaatgcgcttatcgactggagc
ctggcgcgcggcgagcccatcgtcgccagccaggactggcacccggcggatcatggcagc
ttcgccagccagcaccaggtggcaccctacacccagggcgaactcgacggcctggcgcag
accttctggccggatcactgcgtacagcacagcgaaggcgcggcgctgcatccgctgctc
aaacagcaggcgatcaacgccgtgttccataaggggcaaaaccgggtcattgacagctac
agcgctttttttgacaacggtcaccggcagaaaactgaactggacggctggctgcgcggc
cagggcatcgtggaactgaccgtgctcggcctcgccaccgattactgcgtcaaattcacc
gtgctggatgccctggcgctgggctatatggtcaatgtcatcatcgacggctgtcgcggc
gttaacctgcagccgcaggacagcagccaggcgtttatggagatggccgccgcgggcgcc
acgctgtataccctcgatgactggcgggaatctcaggcctga

DBGET integrated database retrieval system