KEGG   Klebsiella pneumoniae 342: KPK_3254Help
Entry
KPK_3254          CDS       T00772                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:kpe00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:kpe00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3308881..3309363
Genome map
AA seq 160 aa AA seqDB search
MTPFYQLTATRLRGQPLSMSDYAGKVVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIEQTCHVNYGVSFPMFEKVDVNGPAAHPLFRYLKQALPGVLGG
RIKWNFTKFLIARDGTPLTRFAPLTTPEKMEASIVAALTR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttttatcaattgacggctacccgcctgcgcggccagcccctctcaatgtct
gactatgctggcaaggtggttctggtggtgaatacggccagccattgtggcttcacaccg
caatacgctggcctggaagcgctctacaaaaagtacgcggctcaggggctggtagtgctt
ggtttcccgtgcaaccagtttggtaagcaggaacccggcggtgcggatgaaatcgagcag
acctgtcacgttaactacggcgtgagcttcccgatgtttgagaaagtggacgtcaacggc
cccgccgcacacccgctgtttcgttatctgaaacaagcgttgcccggcgtgctcggcgga
cggatcaagtggaatttcaccaagttcctcatcgctcgcgacggcacacccctcacgcgt
tttgcgccgttgacgacgccggagaaaatggaggcctccattgtcgcggccctcacgcgc
tga

DBGET integrated database retrieval system