KEGG   Klebsiella pneumoniae 342: KPK_3433Help
Entry
KPK_3433          CDS       T00772                                 

Gene name
tpiB
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPK_3433 (tpiB)
   01230 Biosynthesis of amino acids
    KPK_3433 (tpiB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_3433 (tpiB)
   00051 Fructose and mannose metabolism
    KPK_3433 (tpiB)
   00562 Inositol phosphate metabolism
    KPK_3433 (tpiB)
Enzymes [BR:kpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KPK_3433 (tpiB)
Exosome [BR:kpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KPK_3433 (tpiB)
  Exosomal proteins of bladder cancer cells
   KPK_3433 (tpiB)
  Exosomal proteins of melanoma cells
   KPK_3433 (tpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3454271..3455065
Genome map
AA seq 264 aa AA seqDB search
MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPPFTAIQPVSHFLQMHQ
LPLLTGAQNMHEADQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA
LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSHQQALQILIAYEPVWAIGEHG
TPASPQEAGVIHQALREALCERFGHETGIRIPLLYGGSVTLQNSVELLRQPEINGLFIGR
AAWDAQGYCDIVQRVTQEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgatatggttaggaaccagctggaaaatgaataagccgctgtcgcaggccatg
gcctggtgcgaaacgctggcagcgcggatgccagagggctgtcaccctgctattcagccc
ttcgtcattccccccttcaccgcgatccaacccgtcagccattttctgcaaatgcatcag
ttaccacttttgaccggcgcgcagaatatgcatgaagcggatcagggcgcctggaccggg
gaaatctcggcggccatgttggcagaaaccggcgccacgcttgttgagctgggacattca
gaacgacgcgccgcctttaatgaaagcgatgccgcgattaatcgaaaagtacatagcgcc
ttaggtcatggcctgcgcccactgatctgtattggcgatagcgccgaggagaaacgctgg
caggtgtcgcgtgaaagcgtggtgcggcagatgaagatcgccctgtatggcctgagccac
cagcaagcgctgcagatcctgattgcgtatgaaccggtgtgggccattggcgaacatggt
acgcccgcctcaccgcaggaggcgggcgtcattcatcaggcgttgcgtgaggcgctttgc
gagcggtttggtcatgagacaggaatccgtatcccactgctctatggcggcagcgttaca
ctgcaaaactcggtggaactgctgcgccaaccggagatcaatggcttgtttatcggccgc
gcggcctgggacgcacaaggctattgcgacattgttcaacgcgttacacaggaatttatt
ttgcaggcgcagtaa

DBGET integrated database retrieval system