KEGG   Klebsiella pneumoniae 342: KPK_3433Help
Entry
KPK_3433          CDS       T00772                                 

Gene name
tpiB
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPK_3433 (tpiB)
   01230 Biosynthesis of amino acids
    KPK_3433 (tpiB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_3433 (tpiB)
   00051 Fructose and mannose metabolism
    KPK_3433 (tpiB)
   00562 Inositol phosphate metabolism
    KPK_3433 (tpiB)
Enzymes [BR:kpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KPK_3433 (tpiB)
Exosome [BR:kpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KPK_3433 (tpiB)
  Exosomal proteins of bladder cancer cells
   KPK_3433 (tpiB)
  Exosomal proteins of melanoma cells
   KPK_3433 (tpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3454271..3455065
Genome map
AA seq 264 aa AA seqDB search
MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPPFTAIQPVSHFLQMHQ
LPLLTGAQNMHEADQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA
LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSHQQALQILIAYEPVWAIGEHG
TPASPQEAGVIHQALREALCERFGHETGIRIPLLYGGSVTLQNSVELLRQPEINGLFIGR
AAWDAQGYCDIVQRVTQEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgatatggttaggaaccagctggaaaatgaataagccgctgtcgcaggccatg
gcctggtgcgaaacgctggcagcgcggatgccagagggctgtcaccctgctattcagccc
ttcgtcattccccccttcaccgcgatccaacccgtcagccattttctgcaaatgcatcag
ttaccacttttgaccggcgcgcagaatatgcatgaagcggatcagggcgcctggaccggg
gaaatctcggcggccatgttggcagaaaccggcgccacgcttgttgagctgggacattca
gaacgacgcgccgcctttaatgaaagcgatgccgcgattaatcgaaaagtacatagcgcc
ttaggtcatggcctgcgcccactgatctgtattggcgatagcgccgaggagaaacgctgg
caggtgtcgcgtgaaagcgtggtgcggcagatgaagatcgccctgtatggcctgagccac
cagcaagcgctgcagatcctgattgcgtatgaaccggtgtgggccattggcgaacatggt
acgcccgcctcaccgcaggaggcgggcgtcattcatcaggcgttgcgtgaggcgctttgc
gagcggtttggtcatgagacaggaatccgtatcccactgctctatggcggcagcgttaca
ctgcaaaactcggtggaactgctgcgccaaccggagatcaatggcttgtttatcggccgc
gcggcctgggacgcacaaggctattgcgacattgttcaacgcgttacacaggaatttatt
ttgcaggcgcagtaa

DBGET integrated database retrieval system