KEGG   Klebsiella pneumoniae 342: KPK_3452Help
Entry
KPK_3452          CDS       T00772                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KPK_3452 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    KPK_3452 (nagZ)
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KPK_3452 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3472961..3473983)
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRDASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHEDPQKALTMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
FDPRPASVIRDHDMAVFKSLIAEQRLDAIMPAHVIYPELDPRPASGSAYWLKTVLRGELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TKLYHKGSFSRQELRDSARWKTVSAQLEQLHARWQEAKSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtcatgttggatgtcgaagggtatgaactggatgcggaagagcgagagatt
ctggcgcatccgctggtgggagggttgatcctctttacccgtaattatcacgatccggcg
cagctgcgggagctggtgcgccagatccgcgacgcctcccggaaccatctggtggtggcg
gtcgatcaggaagggggacgcgttcagcgtttccgcgaaggctttacccgtttaccggcg
gcccagtctttcgccgcgctgctggggatggaagaggggggcaaactggccgccgaagcc
ggctggctgatggccagcgaaatgatcgccatggatattgatatcagctttgcgccggtg
ctggacgtcggccatatcagtgccgcgatcggcgaacgttcttatcatgaagatccgcag
aaagcgctgacgatggcgcgtcactttattgacggcatgcacgccgcgggtatgaaaacc
accggtaaacacttcccggggcacggggcggtgactgccgattcgcacaaagagaccccg
ttcgatccgcgtccggcatcggtgattcgcgaccacgatatggcggtattcaaaagcctc
atcgccgaacagcgtctggatgccatcatgcccgcgcatgtgatttacccggagctcgac
ccgcgtccggccagcggctcagcgtactggttaaaaacggtgctgcgcggcgagctgggc
ttcgacggggtgattttctccgacgatctgtcgatggaaggggcggcgatcatgggcagc
tatgccgaacgcggtcaggcgtcgcttgacgccggttgcgatatgatactggtctgcaat
aatcgtaaaggcgcggtcagtgtgctggataacctgtcgccgatcaaagcagagcgtgtt
acgaaattgtatcataaaggttccttttcccgtcaggagttaagggattcagcccgttgg
aaaacggtgagtgcccagctggagcagcttcatgcgcgctggcaagaggcgaagtccgcg
taa

DBGET integrated database retrieval system