KEGG   Klebsiella pneumoniae 342: KPK_3503Help
Entry
KPK_3503          CDS       T00772                                 

Definition
arginase family protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPK_3503
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KPK_3503
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KPK_3503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3521524..3522387
Genome map
AA seq 287 aa AA seqDB search
MTSKTLRLIFPQWQGGNNPPYYLGSQLLSFLSPEAKGPVEIVPVELPTTEPLPGINGITA
KPSLIRQLNNAAALIEKHDPNSIVILGGDCLVSLAPFAHLLDKFGDKLGVLWIDSHPDVQ
TAEQYPNAHAHVLGALMGTGDNDLVAHVKTKLNPSKIMIAGIHAPLPYEAEYLTRHNITT
LAPEQVKSGADEVLEWIAKEKIAYLAIHIDLDVLDPSLFRSILFAKPGRGKHDFGDVAEG
KLTIEDVLNLIAAATTKAVPVGLTIAEHLPWDMLNLKNMLSELPLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgactagcaaaacactgcgacttatatttcctcaatggcaaggcggtaacaatcctccc
tactatcttggctcgcagctcctctcgtttctctctcctgaagcaaaagggcccgttgag
atcgttcctgttgagttaccaacaacagagccattgccagggattaatggcatcacggct
aagccatccctcatcaggcaactcaataatgctgccgcactgattgaaaaacatgatccc
aatagcattgtcattttaggcggagactgcctggtttcgctggcgcctttcgcccacctg
ctcgataagttcggagacaaactcggtgtgctctggattgactcgcatcctgacgtgcag
acggctgaacaatatccaaacgcgcatgcccatgtgcttggtgcgctaatgggtacgggt
gataacgatttagttgcccatgtaaaaaccaaacttaatccgtcaaaaataatgattgcc
ggtatccacgcgccacttccttatgaagctgaatacctcactcgccataacattacgacg
ctagcacctgaacaggttaaaagcggtgcagatgaagtcctggagtggatagctaaagaa
aagattgcgtatctggcgatccatatcgatctggacgtactcgacccatctctgttccgc
tccattctttttgcaaaaccggggcgcggaaaacacgattttggcgacgttgctgaaggc
aaactgacgattgaggatgtactcaatctgatagcggcagcgacgacaaaagcagtcccc
gttggcctgacaatcgctgaacatttgccctgggacatgctgaatctcaagaacatgctc
agtgaattaccccttctaaagtaa

DBGET integrated database retrieval system