KEGG   Klebsiella pneumoniae 342: KPK_3720Help
Entry
KPK_3720          CDS       T00772                                 

Definition
glycosyl transferase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpe00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3766446..3767822)
Genome map
AA seq 458 aa AA seqDB search
MKNTLPADFLWGNSVSSMQTEGAWNEGGKGMSVYDIRQPAEFASDWKVATDSYHRFREDF
DLMQDLGMNCYRFQIAWSRVCPEGDGEFNEEGIAFYHQFIDELIARGIEPMICLYHFDMP
LSLAERYNGFTDRRVMDAFIRYGQKMIDCYGDKVKYWLTFNEQNLYHSPEAFLITGYLRG
DKTLRELYQIQHHVMMAHVHLTHYLHQTKPQCLMGGMLAHALVYPATCKPRDILCAQQLD
EFLNQNLLRAYAGEGYSPEVMHFVARQGFDDIYRPEDIALMATVKVDYLAFSYYASRALN
SDAIPPGTAVNNYMLFGNQDNPYLKATEWNWQIDPLGFRMIITRYYNDWRLPVFPIENGI
GVIESWDGEHPIADDYRIAYHRDHINAMKAAIFEDGAQVIGYLGWGLIDILSSQGDMRKR
YGVVYVNRENHDLKDLRRVPKKSYAWLKQVIHSNGEAM
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacacactaccggcagattttttatggggtaattccgtctccagcatgcagacg
gagggggcgtggaacgaggggggcaaggggatgtcggtgtacgatattcgtcaaccggcg
gaattcgcctcggactggaaggtcgcgaccgactcctatcatcgctttcgcgaagatttc
gatctgatgcaggatctgggcatgaactgctaccgcttccagatcgcctggagccgggtg
tgcccggaaggggacggcgaattcaatgaagaggggatcgcgttctaccatcagtttatc
gatgaactcattgcccgcggtattgaaccgatgatctgcctgtatcactttgatatgccg
ctgtcgctggcggagcgttacaacggttttaccgaccgccgggtcatggacgcctttatc
cgctatggccagaagatgatcgactgttacggcgataaggtgaagtactggctgaccttc
aatgaacagaacctctaccattcgccggaagccttcctgatcaccggctatttgcgtggc
gataaaacgctgcgcgaactctaccagatccagcaccacgtgatgatggcgcatgtccat
ctgacccactatctgcatcagacgaagccgcagtgcctgatgggcggaatgctggcccat
gcgctggtctatccggctacctgcaaaccacgcgatattctctgcgcccagcaactggac
gagtttttaaaccagaacctgctgcgcgcctacgccggcgagggttatagcccggaagtg
atgcattttgtcgctcgccaaggctttgacgatatttatcgccctgaagatatcgcgctg
atggcgacggtgaaggtcgattatcttgcgttcagctattacgccagccgtgcgctcaat
agcgacgcgatcccgccgggaacggcggtcaacaattacatgctattcggtaatcaggat
aacccgtacctgaaagcgacggaatggaactggcagatcgatccgctgggatttcgcatg
atcatcacccgctattacaatgactggcggctaccggtgttcccgattgaaaatggcatc
ggggtgatcgaatcctgggatggcgaacatcccattgccgatgattaccgcatcgcctac
catcgcgaccatattaacgccatgaaagcggcgatatttgaggacggcgcgcaggtgatt
ggctatctcggctggggattaatcgatatcctcagctctcagggcgatatgcgtaagcgc
tacggcgtggtgtacgtcaatcgtgagaaccatgacctcaaggatctgcggcgggtgccg
aagaagagctatgcgtggctaaagcaggtgatccacagcaacggcgaagcgatgtaa

DBGET integrated database retrieval system