KEGG   Klebsiella pneumoniae 342: KPK_3782Help
Entry
KPK_3782          CDS       T00772                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPK_3782
   00500 Starch and sucrose metabolism
    KPK_3782
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     KPK_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3830689..3831972
Genome map
AA seq 427 aa AA seqDB search
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTTARPILNADEAKNFTPAAYFQ
SLTPNAAAWTPSAISLPAQPDFIVGPAGTQGVTHTTVQAAVDAAIARHSNRRLFIAIMPG
EYPGTVYVPAAPGALTLYGTGDKPIDVKISEAIDSEMDRNTWRRLVNPGGKYMPGKPAWY
MFDSCQNKSAATVGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVALRTDGDQV
QINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIR
DSVINEGFNIAQPWAAAVGSNRAFSGNVGAVDAKGNLQRNLNDNSVNRMWEYNNRGVGST
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatattccgtttcccgtctggcgctggcgctggccttcggcgtgacgctgtcc
gcctgtagctcgacgcctgccgatcaacagccctctacgcagactgcaccgggcaccacc
gcgcgtcccattctgaacgccgatgaagcgaaaaactttaccccggcggcctatttccag
tcgctgactcccaatgccgcggcctggacgccatctgccatcagcctgccggcgcagcct
gactttatcgttggcccggcgggaacccagggcgtgacccataccaccgtccaggcggcg
gtcgatgcggcgattgcccgtcattcaaatcgccgtctgtttattgccatcatgcctggc
gagtacccgggaacggtttacgtaccggcggcgcctggcgccctgaccctgtatggtacc
ggcgataaaccgattgacgtgaaaatcagcgaagccattgattctgaaatggatcgcaac
acctggcgccgtctggtcaatccgggcggtaaatatatgccgggcaaaccggcatggtat
atgttcgatagctgccagaataaatccgcggccaccgtcggcgtgatgtgctctgcggtc
ttctggtcgcagaataacggcctgcagctgcagaacctgaccatcgccaacaaccttggc
gacagcgtcgacgccggtactcaccaggccgtcgccctgcgcaccgatggcgatcaggtg
cagatcaacaaggtcaatattcttggccgtcagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaggataaccgccagacccgcaccctggtgaccaacagctacatt
gaaggcgatgtggatatcgtgtccggtcgcggcgcggtggtatttgataacaccgatttc
cgcgtggtgaactcgcgtacccagaaagaagcctatgttttcgcgccggctaccctgaag
agcgtgacctacggcttcctggcgaccaacagccgctttaccgcgtccggcgataacgtc
gcgcagctgggccgcgcgctggacgttgacggcaacagcaatggccaggtcgtgatccgc
gacagcgtcatcaatgaaggctttaacatcgcccagccgtgggcggcagcggtcggttca
aaccgtgcctttagcggtaacgttggcgcagtagatgccaaaggcaatctgcagcgcaac
ctcaacgacaatagcgtcaatcgcatgtgggaatataacaaccgcggcgtgggaagcact
gtggtcgccgagccgaaacagtaa

DBGET integrated database retrieval system