KEGG   Klebsiella pneumoniae 342: KPK_3981Help
Entry
KPK_3981          CDS       T00772                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KPK_3981
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KPK_3981
Exosome [BR:kpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPK_3981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4031352..4032872
Genome map
AA seq 506 aa AA seqDB search
MQATAKEFIIALDEGTTNAKAVVLDSRGKVIVKFSQPLAIQTPRDGWVEQSGEALVTASL
AVIASAVAHVGAENVAALAISNQRETAIGWYRDSGEPINAAITWQCTRSAAFCDTLRHDR
QEQHIKRATGLPIAPLFSASKMRWLLDATVDGHLRAERGEICLGTIDSWLLWNLTAGEAF
CCDYSNAARTQLLNLHRGEWDDEMLTLFGIPRAALPDIKPSSGLFGHTKGLAAIPDGIPI
MAMIGDSHAALFGHALGEAGCVKATYGTGSSVMAPVKSAQCDIDALATTVAWHDGDQLVW
GLEGNIPHTGDAVAWMADSTGLSELSAAELAHELNTLPASVDSTLGVYFVPALTGLGAPW
WDDSARGLICGLSRGVKRAHLIRAALESITYQIADVVVAMRQHEEFTLTALMVDGGPTNN
DWLMQYQADLLGCPVMRSDVPELSAIGAALLARKALHPGSTADLQAFLTEHSTFQPDMAR
HQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacagcaaaagagttcatcattgccctggatgaaggcaccaccaacgccaaa
gcggtggtgctggatagccggggcaaagttatcgtcaaattctcgcagccgctggcgatc
caaacgccgcgcgacggctgggtggagcaatcgggcgaagcgctggttaccgcctcgctg
gcggtgatcgccagcgcggtggcccacgttggcgcggaaaacgtcgccgcgctggccatc
agcaaccagcgggaaaccgccatcggctggtatcgcgacagcggtgaaccgattaacgcg
gcgatcacctggcaatgcacccgcagcgccgcgttctgcgacacactgcgtcacgatcgc
caggaacagcacattaagcgtgccaccggcctgccaatcgccccgctgttctcggcctcc
aaaatgcgctggctgctggatgcgactgtcgatggccacctgcgtgccgaacgcggtgag
atttgcctcggcaccatcgacagctggctgctgtggaatctgaccgctggagaagccttc
tgctgcgactactccaatgccgcccgcacccagctgctgaacctgcaccgcggcgagtgg
gacgacgagatgctgacgctgttcggcattccgcgcgcggcgttgccggacattaaaccg
tcgagcggcctcttcggccataccaaaggactggccgccattccggacggtattccgatc
atggcgatgatcggcgactcccacgcggcactgttcggccacgcgctcggcgaggcaggc
tgcgtcaaagccacctacggcaccggctcttcggtcatggccccggtcaaatcggcccag
tgcgatatcgacgcgctggcgaccactgtcgcctggcacgatggcgaccagctggtgtgg
ggcctggaagggaatattcctcacaccggcgatgccgtcgcctggatggcggacagcacc
ggactgagcgaactctctgccgccgagctggcccatgagctgaataccctccccgcctcc
gtcgactcaaccctcggggtctacttcgtgccggcgctgaccggtcttggcgcgccctgg
tgggacgacagcgcccgcggcttgatttgcggcctgagtcgcggggtgaaacgcgcgcat
ctgatccgtgcggcgctggagtccatcacctatcagatagccgacgtggtggtagcgatg
cgtcagcatgaggagttcaccctgacggcgttaatggtggacggcgggccgaccaacaat
gactggctgatgcaataccaggccgatctgctcggctgcccggtgatgcgcagcgacgtg
ccggagctgtccgccatcggcgcggcgttgctggcgcgcaaagcgctccatcctgggtcg
accgccgatctgcaggccttcttaaccgaacacagcacctttcagcccgacatggcccgc
caccagcgtttacaaacgcgctggcaggagtggcgccatgcggtcgaccgaacattatgg
aaaccggactcgccagcctga

DBGET integrated database retrieval system