KEGG   Klebsiella pneumoniae 342: KPK_4007Help
Entry
KPK_4007          CDS       T00772                                 

Definition
hypothetical protein
Orthology
K15372  
taurine---2-oxoglutarate transaminase [EC:2.6.1.55]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPK_4007
   00430 Taurine and hypotaurine metabolism
    KPK_4007
Enzymes [BR:kpe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.55  taurine---2-oxoglutarate transaminase
     KPK_4007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4058948..4060285)
Genome map
AA seq 445 aa AA seqDB search
MKLALQNEVAVSNDEVRQLDRAYVFHSWSMQGNLHPLVIAGAQGCELWDYEGNTWLDFSS
QLVNVNIGYQHPRVLAAMKAQLETLVTIAPATANLARGEAAKRIVDLAPAGFSKVFFTNA
GADANENAIRMARLYTGRDKVLSAYRSYHGNTGSAIAATGDWRRVPNEFSRGHVHFFNPY
LYRSEFNAATEEEECQRALAHLRRIIECEGPTAIAAILLESIPGTAGILVPPAGYMQGVR
ALADEFGIVLILDEVMAGFGRTGSWFAFEQDGVVPDLVTFAKGVNAGYVPAGGVLISEPI
ARYFDDHFFAGGLTYSGHPLAMAAIVATIDAMKEEKVVENAAYIGNEVLRPGLEALAEKH
AIIGEVRGRGLFQALELVSSREQKTPLTAADMAAIKGALTEAGLLAFVVENRIHVVPPCT
ITAEQVAQGLAIFDAVFARFASLAK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggcactacagaacgaggtcgcggtaagcaatgatgaagttcggcagctggat
cgcgcttatgtgtttcattcatggtcgatgcagggcaatctccatccgctggtgattgcc
ggggcgcaaggctgcgagctatgggattacgaggggaatacctggctcgatttcagcagc
cagctggtgaacgtcaacattggctatcagcacccccgggtactggcggccatgaaggcg
cagctggagaccctggtcaccatcgcgcccgccaccgccaaccttgcccgcggcgaagcg
gcgaagcgcatcgtcgacctggcgccggcgggcttcagcaaggtgttcttcaccaacgcc
ggggcggatgccaatgagaacgcgattcgcatggcgcggctctataccgggcgcgacaag
gtgctgtcggcctatcgttcctatcatggcaacaccggcagcgcgatcgccgccaccggc
gactggcgccgggtgccgaatgagttctcccgcggccatgttcacttcttcaacccctac
ctttaccgcagcgagttcaacgccgcgactgaagaagaggagtgccagcgcgcgctggcg
catctgcggcggatcatcgaatgcgaggggccgaccgccatcgcggcgatcctgctggag
tccatccccggcaccgccgggatcctcgtgccgccggcaggctatatgcagggtgtgcgc
gccctggccgacgagtttggcatcgtgctgatcctcgatgaggtgatggccggctttggc
cgtaccggcagctggttcgccttcgagcaggatggcgtggtgccggatctggtgaccttt
gccaaaggggttaacgcgggctacgtgccggcgggcggggtgctgattagcgagccgatt
gcccgctattttgacgaccacttttttgccggcgggctgacctactccggccatccgctg
gcgatggcggcgattgtcgccaccatcgacgcgatgaaagaggagaaggtggttgagaac
gcggcctatatcggcaacgaggtgctgcgccccggtctcgaggcgctggcggagaagcac
gccattatcggcgaggtgcgtggtcgcggcctgttccaggcgctggagctggtgagcagc
cgtgaacaaaaaacgccgctgactgccgccgacatggccgcgatcaaaggggccttaacc
gaggccgggctgttggcctttgtggtggagaaccgcattcacgtggtgccgccgtgcacc
attactgctgagcaggtggcgcaagggctggcgatttttgatgcggtctttgctcgcttt
gccagcctggcgaagtag

DBGET integrated database retrieval system