KEGG   Klebsiella pneumoniae 342: KPK_4149Help
Entry
KPK_4149          CDS       T00772                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kpe  Klebsiella pneumoniae 342
Brite
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KPK_4149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4209737..4210240)
Genome map
AA seq 167 aa AA seqDB search
MAMTPKLRNSVIAAVGGGAIAIASALITGPTGNDGLEGVRYDPYQDVVGVWTVCYGHTGK
DIMLGKKYTEAECRALLSKDLNTVARQINPYIQKPIPETMRGALYSFAYNVGAGNFQTST
LLRKINQGDQKGACDQLRRWTYAKGKQWKGLVTRREIEREVCLWSQK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctatgacaccaaaactgaggaatagcgttatcgctgccgtcggcggtggcgccata
gccattgcttcagcgcttatcaccggcccgaccggtaacgatggtcttgaaggtgtgcga
tacgacccctatcaggatgtggtaggcgtctggactgtctgctatggccacactggcaaa
gacatcatgctcggcaagaagtacaccgaggcggaatgccgtgcgctgctcagtaaagac
ctgaacaccgtcgcccgccagattaacccatacatccagaagccgatccccgagacaatg
cgcggggctctgtactcgttcgcctataacgtcggcgctggcaatttccagacctccacg
ctgctgcgcaaaatcaaccagggagaccagaaaggtgcatgcgaccagttgcgccgctgg
acctacgcaaaaggcaagcagtggaaaggcctggtaacccgccgcgagattgagcgcgaa
gtatgtctctggagtcaaaaatga

DBGET integrated database retrieval system