KEGG   Klebsiella pneumoniae 342: KPK_4249Help
Entry
KPK_4249          CDS       T00772                                 

Gene name
bgaB
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPK_4249 (bgaB)
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KPK_4249 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4285796..4287853)
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDTILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLEINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEVSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWQLAEALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVSQLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYRLVIAPMLYMVRDGFAARAE
AFVASGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHTESAQTLATYRDDFYAGRPAVTVNGFGKGKAWHVASRNDLA
FQRDFFAALSRELDLPRAIAADLPPGVVATARTDGESTFVFLQNYSAQSHILTLPPGYWD
CLTDAAAPDPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgaccccgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccgcgc
gaaggggtatttaatttcgcctggctggatactatcctcgataaactgtatgccgccggc
attcatgtttttctggccacgccgagcggcgcgcgtccggcgtggatgtctcagcgctat
ccgcaggttctgcgggtgggacgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctggaaatcaataccctgcttgca
gagcgttattcttcacacccggcggtactgggctggcatatttccaatgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctataccgac
tggtcgcaaattgaatcacctgcgccacagggcgaggtgtcaattcacggtctcaatctt
gactggcatcgctttaacaccgctcaggtgaccgatttctgccgccatgaaattgccccg
ctgaaggcggctaacgcctccctgcctgtgaccactaactttatggagtatttctacgat
tacgactactggcaactggcagaggcgctggactttatctcgtgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcactggcctgctacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccacaccaggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctctcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcggtggttgaccacgtcgggcacattgatacccgtattggt
cgtgaagtcagccagctcggcgagatactgagcaagctaccggaggtccggggttgtcgc
accgaggcgaaagtagcgattatcttcgaccaacaaaaccgctgggcgcttgatgacgcc
caggggccgcgcaatctgggtatggagtatgagaagacggtcaacgaacactaccgtccg
ttctgggaacagggcattgccgtcgatgtgattgacgctgatgtcgatttaacgccatac
cggttagtgattgccccgatgttatatatggtgcgcgacggctttgccgcgcgggcagag
gcgtttgtcgccagcggcggccacctggtgaccacctactggaccggcatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctggggatctgg
gcggaagagatcgactgtctgaatgacggcgagtttaatcttgtgcaggggcttgccggg
aatcagtgcggtctgcagggtccctatcaggtgcgccatctctgtgaactaatccatacc
gagagcgctcagacgctggccacctaccgggatgatttctatgccggacggccggcggtg
acggtgaacggtttcgggaaaggtaaagcctggcatgtcgcctcccgcaacgatttagcc
ttccagcgcgatttctttgctgccctgagcagggagctggatctgccacgagcgatagcg
gcggatttaccgcccggcgtagtggctaccgcgcgcaccgacggtgagagcacgtttgtc
ttcctgcagaactacagcgcgcaaagtcatattctgactctgccgccggggtattgggat
tgcctgaccgacgcggcggcgccggacccgctgacactctcagcatgggattgccgtatt
cttcgtcgtcacgcctaa

DBGET integrated database retrieval system