KEGG   Klebsiella pneumoniae 342: KPK_4409Help
Entry
KPK_4409          CDS       T00772                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpe01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kpe00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4442624..4443727
Genome map
AA seq 367 aa AA seqDB search
MSESQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAMGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNSIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQPGLFTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGNRPD
VIGHAMEGLPVGTCFHAQESPLENRKRWIFGAPPAGELTVDAGATQAILERGSSLLPKGI
KIVSGNFSRGEVIRIRNSEGRDIAHGVSRYNSDALRLIAGQHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagccagacgctggtggtaaaactgggcaccagtgttttaacaggcgggtcc
cgccgcctgaaccgcgcccatatcgttgagctcgtgcgccagtgcgcacagctgcacgcc
atgggacaccgtattgtcatcgtgacctccggggccattgccgccgggcgcgagcacctt
ggttacccggaactgcccgccaccatcgcctccaagcagctgctggcggcggtgggacaa
agccgtctgatccagctgtgggaacagctgttttctatctatggcattcacgttggccag
atgctgctgacccgcgccgacatggaagacagagaacggttcctcaacgcccgcgacact
ctgcgcgcgctgctggataacagcatcgtcccggtcattaacgaaaacgacgccgtcgcc
accgcggaaatcaaagtgggcgataacgacaatctctccgcactggccgcgatcctcgcc
ggggcggataagctgctgctgttaaccgaccagccaggcctgttcaccgccgacccgcgt
agcaacccgcaggcggagctgattaaagacgtctacggcatcgacgacgcgctgcgcgcc
atcgccggcgacagcgtctccggactcggcaccggcggcatgggcaccaagctgcaggcc
gcggatgtcgcctgccgcgcggggattgataccattatcgccgctggcaaccgcccggac
gtcatcggccatgcgatggaaggcctgccggtaggcacctgcttccacgcgcaggagtct
ccgctggagaaccgtaagcgctggatcttcggcgccccgccggccggtgaactgaccgtc
gatgcgggcgcgactcaggcgatcctcgaaagaggcagctcgctgttgccaaaaggcatc
aaaatcgtcagcggcaacttctcccgcggcgaagtgatccgcatccgcaatagcgaagga
cgcgatatcgctcacggcgtcagccgctacaacagcgatgcgctgcgccttatcgccggc
cagcactcgcagcaaatcgatgccattctgggctacgaatacggcccggtggccgtccac
cgcgatgatatgatcatccgttaa

DBGET integrated database retrieval system