KEGG   Klebsiella pneumoniae 342: KPK_4462Help
Entry
KPK_4462          CDS       T00772                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase, acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00010  Glycolysis / Gluconeogenesis
kpe00020  Citrate cycle (TCA cycle)
kpe00620  Pyruvate metabolism
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01130  Biosynthesis of antibiotics
kpe01200  Carbon metabolism
Module
kpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_4462 (acoC)
   00020 Citrate cycle (TCA cycle)
    KPK_4462 (acoC)
   00620 Pyruvate metabolism
    KPK_4462 (acoC)
Enzymes [BR:kpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KPK_4462 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl SLD3
Motif
Other DBs
NCBI-ProteinID: ACI09444
UniProt: B5Y1C0
Position
4489643..4491178
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
IIAREGETLQVGAVLALAADASVSDAELDEFAASLATVKPAAPGPEDAAPDLAAQAGAKP
PSVVSPPSNSPEPPIGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGD
RISVSDLESAIVAAGGRLASPTPPVRRSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAAALLLDEHPQTSPVQKSAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLAFRQEINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEATQ
SIRRFADADISVAVALPDGLITPIVRSANRKSISDISAEIHALVTRAKAGTLKPEEFQGG
TFSVSNLGMLGVRQFDAIINPPQSAILAIGTGEMRAVVRDGQIVARHQLTVSLSCDHRVI
NGAAGAAFLRELKRLTETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatctgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggcaccttttgccggtacattacgccgg
ataatcgcccgggagggtgagacgcttcaggttggcgccgtgctggctctggcggctgac
gcttcggtcagcgatgctgaactggacgaatttgctgccagtctggcgacggtgaaaccc
gcagcacctggcccggaggatgccgcgccggacctagcggcacaggcaggcgctaagcca
ccttccgttgtttcgccgccatccaacagtccggagccccctattgggcagaccgtcatt
cccgtcagtctgcaaggcgtgactgatgtgactcaggttaatgccacgccccatgcgtta
agactgtctgcccgctggggtgtcgacctgaaaaaagtccgcggcagcgggcgcggggat
cgtatctctgtttctgatctggaaagcgcgatcgttgccgccggcggtcgtctggcctct
ccgacgccccccgttcgtcgcagtaaagcgccccgctcgcatgccgatgatagccaggta
tcggccaccccgctggcgcgccgtctggccggcaaactgggtatcaacttacatgactgc
cgaagcagcggttcacgcggtcgggtgagtcgcgatgatgtgctggccgcggcgttgtta
ctcgacgagcacccgcagaccagccctgtgcagaagagtgccccggcaccctttgagagc
atcccgatgtccggtatgcggcgggctatcgcttctcgcttgcaaacctctaagcaacag
tctccccatttccgtttgagtgtcgatctcgatctggaacgactgttagcgtttcgtcag
gaaattaaccgcgaagtacccggtgtcaagatttcggttaacgacctgctggtgaaagcc
tgtgccctggcgctggtggccgtgccagacgtcaacatccagtttgatgaagcgacacaa
agtatccgccgctttgcggatgccgatatttcggtggctgttgcgctgcctgacgggcta
attacccccattgttcgctcggcgaaccggaaatcgatcagcgacatatcggccgaaatt
cacgccctggtgaccagggccaaagcgggcacgctgaagccggaagagttccaggggggg
acctttagcgtgtcaaatctggggatgctcggcgtacggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcaccggcgagatgcgggcggtagtacgcgac
gggcaaatcgtcgcgcgccaccaactgacggtatcgctatcctgcgatcaccgggtcatc
aatggggcggcaggtgcagcttttctccgggaactcaagcgactgactgaaaccccaacc
ctgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system