KEGG   Klebsiella pneumoniae 342: KPK_4547Help
Entry
KPK_4547          CDS       T00772                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00900  Terpenoid backbone biosynthesis
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01130  Biosynthesis of antibiotics
Module
kpe_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPK_4547 (dxr)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     KPK_4547 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ACI10238
UniProt: B5Y1J8
Position
complement(4575689..4576891)
Genome map
AA seq 400 aa AA seqDB search
MKQLTVLGSTGSIGCSTLDVVRHNPGCFSVAALVAGKNVDRMVEQCLEFTPRYAVMDDAQ
SAERLRTRLHEHCCRTEVLSGQQAAAEVAALDEVDQVMAAIVGAAGLVPTLAAIRAGKTV
LLANKESLVTCGRLFMEAVQRSGARLLPVDSEHNAIFQSMPETIQQHLGYADLTRNGVSS
ILLTGSGGPFRETDVAELSAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAQQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMGWPQRLSSGVKPLDFC
QLSNLSFSAPDYARYPCLKLAMDAFDVGQAATTALNAANEESVAAFLHGDIRFTDIAAVN
LAVLDKMNLQEPQSIDDVLVIDADARAVAHQQLNRLGAQA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaccgttctcggttcgaccggctccattggctgtagcacgctggacgtg
gtacgccataaccctggttgcttttccgtcgccgcgctggtcgcggggaaaaacgttgac
cgcatggttgaacaatgcctggaatttactccgcgttacgccgtgatggatgatgcgcaa
agcgctgagcggttgcgcacccgtctgcatgagcattgctgccgtaccgaggtgctgagc
ggccagcaggcggcggctgaggtcgcggcgctggatgaggtcgatcaggtgatggcggca
atcgtcggcgcggcggggctggtaccgacgcttgcggcgatccgcgccgggaaaaccgtg
ttgttggcgaataaagaatcgctggtgacctgcggtcgcttgttcatggaggccgttcag
cggtcgggggcgcgattgctgccggtcgatagcgaacataacgcgatttttcagagtatg
ccggagacaattcaacagcatctgggatacgctgacctcacccggaatggcgtctcgtcc
attctgttaaccggttccggggggcctttccgcgagacggacgtggctgaactatcggcg
atgaccccggatcaggcctgccgccatcccaactggtcgatgggacgtaagatctccgtc
gattcagccacgatgatgaacaaaggtctggaatatattgaagcgcgctggctgttcaat
gcttcggcgcagcagatggaagtgctgatccacccgcagtcggtgatccactcgatggtt
cgctatcaggacggcagcgtgctggcccagcttggggagccggatatgcgcacgccgatt
gctcataccatgggctggccacagcgcctgagctccggggtcaaaccactggacttctgc
cagctgagcaacctgagcttctccgcgccggactacgcccgctatccctgcctgaagctg
gcgatggacgcgtttgacgtcggccaggcggccaccacggcgctgaatgcggccaatgaa
gagtcggttgccgcgtttctgcatggcgatatccgctttaccgatattgcggcggtgaat
ctggcggtgctggataagatgaacctgcaggagccgcaaagcattgatgatgttctggtt
atcgacgctgacgctcgtgcggtagctcaccagcagcttaatcgtttgggcgcgcaggcg
taa

DBGET integrated database retrieval system