KEGG   Klebsiella pneumoniae 342: KPK_4753Help
Entry
KPK_4753          CDS       T00772                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPK_4753 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPK_4753 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KPK_4753 (thrC)
Enzymes [BR:kpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KPK_4753 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4804055..4805335)
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDDMLAQDFVTRSAKILS
AFIGDEIPQDVLQQRVRAAFAFPAPVSKVQDDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKATLGLNSANSINISRLLAQICYYFEAAAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRYLQGGEWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDETTKAAMRELKAIGYISEPHAAIAWRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgagcaggtcagctttgcgcaggccgtcacc
caggggcttggcaagcatcagggtctgttctttccgcacgatctgccggaattcagcctg
actgaaatcgacgacatgctggcgcaggattttgtcacccgcagcgccaaaattttatcg
gcctttatcggcgatgagatcccgcaggatgtcctgcagcagcgggtgcgcgcagcgttt
gcgtttccggcgccagtaagcaaggttcaggacgatgtcggctgcctggagctgttccac
ggcccgacgctggcgtttaaagattttggcggccgctttatggcgcagatgctgacccat
atcgccggcgataagccggtcaccattctcaccgcaacctccggcgacaccggggcggcg
gtggcgcatgccttctacggtctgccgaacgtcaaggtcgtgatcctctatccgcgcggt
aagatcagcccgctgcaggagaagctgttctgtaccctcggcggcaacattgaaaccgtg
gcgattgatggcgactttgatgcctgccaggcgctggtgaagcaggcgtttgacgatgaa
gagctgaaggccacgctggggctcaactcggctaactccatcaacatcagccgcctgctg
gcgcagatctgctactacttcgaagcggcggcgcagctgccgcaggaagctcgcaatcag
ctggtgatttccgtgccaagcggcaacttcggcgatctgaccgctggtctgctggccaag
tcgctgggtctgccgattaagcgctttattgccgccaccaacgcgaacgacaccgttccc
cgttatctgcagggtggcgagtgggcgccaaaagccacccaggcgacgctgtctaacgcc
atggacgtcagccagccgaacaactggccgcgcgtcgaggagctgttccgccgtaaaatc
tggcgcctgagcgagctgggttacgccgcggttgatgatgagaccaccaaagcggcgatg
cgcgagctgaaggccatcggctacatctctgagccgcacgcggcgattgcctggcgcgcg
ctgcgcgatcagctgcagccgggagagtacggcctgttcctcggtaccgcgcatccggcg
aaattcaaagagagcgtggaagagatcctgcaggaaaccctgccgctgccgaaggagctg
gctgaccgcgccgacctgccgctgctgtcccacaatctgccggcggatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system