KEGG   Klebsiella pneumoniae 342: KPK_4776Help
Entry
KPK_4776          CDS       T00772                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KPK_4776 (deoA)
Enzymes [BR:kpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     KPK_4776 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4829621..4830943)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLNWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYDHYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDHVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEITPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcattaagcgatgaa
gagatccgctttttcatcaacggcatccgcgacaatactatctcagaagggcaaatcgcc
gcgctggcgatgaccattttcttccacgatatgtccatgccggagcgtgtttcgctgacc
atggcgatgcgggattccggcaccgttctcaactggaaaagccttaacctcaacggcccg
atcgtcgataaacactccaccggcggcgtgggtgacgtgacctcgctgatgttggggcca
atggtggccgcctgcggcggttatgtaccgatgatctccgggcgtggcctcggccatacc
ggcggtacgctggataaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgctttcgcgagattattaaagatgtcggcgtggcgattatcgggcagaccagctcgctt
gctccggccgacaaacgtttctatgccacccgcgatattaccgcgacggtggactccatc
ccgctgattaccgcctcgattctggccaagaaactggcggaagggctggacgcgctggtg
atggacgtcaaagtcggcagcggcgcctttatgccgacttatgaactctctgccgcgctg
gccgaagcgatcgtgggtgttgccaacggcgccggcgtgcgtaccaccgcgctgctgacc
gatatgaatcaggtgctggcatccagcgccggcaacgccgttgaagttcgcgaagcggtg
cagttcctgaccggcgaatatcgcaacccacgcctgttcgacgtgacgatggcgctgtgt
gtggaaatgctgatctccggcaagctggcggcggatgacgccgaggcgcgcgcgaagctg
caggcggtgctggataacggtaaagcggcggaagtctttggccgcatggtcgcggcgcag
aaagggccgaccgactttgtcgagaattatgatcattatctgccgacggcgatgctgagc
aaagcggtctatgctgataccgaaggttttatcagcgcgatggatactcgcgcgctggga
atggcagtggtttctatgggcggcggccgccgccaggcatcagataccattgactatagc
gttggctttaccgatatggcgcgtctgggtgaccacgttgacggacagcgtccgctggcg
gtgatccatgccaaagacgagaacagttggcaggaggccgcgaaagcggtcaaagcggcc
attaaactggacgataaagccccggaaattacaccgacagtctatcgccgcatcactgaa
tag

DBGET integrated database retrieval system