KEGG   Klebsiella pneumoniae 342: KPK_5057Help
Entry
KPK_5057          CDS       T00772                                 

Definition
glycosyl hydrolase family 42
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPK_5057
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KPK_5057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5111208..5113217
Genome map
AA seq 669 aa AA seqDB search
MSHLFYGVAYYDEYMPEDRLAKDIALMRETGINVVRIAESTWSTLEPEEGQYNFYHIDRV
LEAMHEAGIAVIVGTPTYAVPAWLAAKHPDILVTTVAGQQKYGPRQIMDIVNPTFRRYAE
KIIRTLMAHVQHHPAIIGWQLDNETKHYDNIGRYMQEGFVRSLQEKYPDLRQLNRDFGLD
YWSNRIDRWQDFPPVENTINASLACAFSRYQRQQVTEYLAWQAAIVREYAQPHQFVTHNF
DFEWRGYSYGVQPRVDHFAAAQALDIAGVDIYHPSQAHLTGREIAFGGAITRSLKPGQNY
FVLETQAQGFAQWTPFPGQLRLQAFSHIASGAAMVSYWHWHSIHNAFETYWKGLLSHDFS
RNPTWQEATTIGADFARLSPQLAELKAENDVALLISNEAMDALNHFRPGDAEGNIYNDIF
RRFHDALYDHNISLDIIHDVNEETSRYRVLIVPGLYAADDGLLTRINDYIARGGRALIGF
KSGFSDENVKVRNSAQPGILRQSCGVSYSQFTLPEGTTVSSCCAEIDCRNDNQAELWMEL
LTPDGGTRTLLRYQHPAWGEYAAATAADYGQGRALYVGFLPHKRLISQLFDVLTADLTLN
SRTSAYRYPLVVKKMRNRAGNTIHFLFNYSGEALDVVSETAGTALLSGEAVDVGQPLRLR
AWEFTIIES
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatttattttatggcgtggcatattacgatgaatatatgccggaagatcggctg
gctaaggatatcgccttaatgcgcgaaaccggcattaacgtggtgcgtattgccgagtcc
acctggagtacgctggagcctgaagagggccagtacaatttctaccatatcgaccgggtg
ctggaggcgatgcatgaggccggcattgcggtcatcgtcgggacgccgacctatgcggta
ccggcctggctggcggcgaaacatcccgatattctggtcaccaccgtcgcggggcagcaa
aaatatggcccgcggcagatcatggatatcgtcaatccgacctttcgccgctatgccgaa
aaaattatccgcacgctgatggcccatgtgcagcaccatccggcgattatcggctggcaa
ctggataacgaaaccaagcattacgacaatattggccgctatatgcaggagggcttcgtg
cgcagcctgcaggagaaatatcctgacctccggcagctgaatcgcgatttcggcctggat
tactggagcaaccgcattgaccgctggcaggattttccgccggtggaaaacaccatcaac
gccagcctcgcctgcgccttctcccgctatcagcgtcagcaggtcaccgagtatctggcc
tggcaggcggccatcgttcgggaatacgcccagccgcaccagttcgtcacccacaacttc
gatttcgaatggcgcggttactcttacggcgtgcagccgcgggtcgaccattttgcggcg
gcgcaggcgctggatatcgccggcgtcgatatctatcatccgagccaggcgcacctgacc
gggcgggaaatcgcctttggcggcgccatcacccgctcgcttaagccgggtcagaactac
ttcgtactggaaacccaggctcagggcttcgcccagtggacccccttcccgggccagcta
cgcctgcaggcattcagccatatcgcctccggcgccgccatggtctcctactggcactgg
cattcgattcataacgccttcgaaacctactggaaggggctgctcagtcacgacttctcg
cgcaacccaacctggcaggaagccaccaccatcggcgccgatttcgcccgcctgtcgccg
cagctggcggagctgaaggccgaaaatgacgtcgcgttgctaataagcaatgaggcgatg
gacgccctcaatcacttccgtcccggcgatgccgagggcaacatttataacgatatcttc
cgccgcttccacgatgcgctgtatgaccacaatatcagcctcgacatcatccacgatgtg
aacgaggaaacctcgcgctaccgggtactgatcgttcctggtctgtacgccgccgatgat
ggcctgctaacacggattaacgactatatcgcccggggcggcagagcgctgatcggcttt
aaatcaggctttagcgatgaaaatgtcaaggtgcgcaacagcgcgcagccggggattttg
cgccagagctgcggcgtcagctacagccagttcaccctgccggaagggacgacggtaagc
tcatgctgcgcagagattgattgccgcaatgataatcaggctgagctgtggatggaattg
ctgacgcccgatggcggaacccgcacactgctgcgctatcagcatccggcatggggcgaa
tacgccgccgcaacggcggcggattacggtcagggacgcgccctgtacgttggcttcctg
ccgcacaagcgcctgattagccagctgtttgatgtcctgacggcggatctcacgctgaac
tcgcgaacttccgcctatcgctatccgttagtggttaaaaagatgcgtaaccgagccgga
aatactatccacttcctgttcaattactccggcgaggcgctggatgttgtcagcgagacc
gcgggtaccgcgctgctgagcggggaggctgtagacgtcggccagccgttgcgcctcagg
gcctgggaatttactatcatcgaaagctaa

DBGET integrated database retrieval system