KEGG   Klebsiella pneumoniae 342: KPK_5191Help
Entry
KPK_5191          CDS       T00772                                 

Gene name
acsA
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:kpe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpe00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:kpe00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:kpe00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:kpe00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5244444..5246402
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPANIAERCLINPEQYKAQYQQSITDPDTFWGEQGKILDWIRPYTRVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDASQSKHITYRELHADVCRF
ANALLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGLRAGRAIPLKKNVDDALKNPNVNSIEHVVVLKRTGGKIDWQEGRDLWWSDL
MANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVSILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPVLVDNEGLPLDGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacacaaacaccctattcccgctaatatcgcggaacgttgcctgattaac
ccggaacagtacaaggcgcagtaccaacaatccataaccgaccctgatacattttggggc
gagcagggcaagatccttgactggatacgcccctatacccgcgtgaagaacacctctttc
gcgccgggtaatatttccatcaaatggtatgaagatggcaccctgaacctcgccgccaac
tgcctcgaccgccatctcgccgagcgcggcgatcaaaccgccatcatctgggaaggcgac
gacgccagccagagcaagcacatcacctaccgtgaactgcatgcggacgtgtgccgcttc
gccaatgcgctgctcgaccttgggattaaaaaaggcgatgtggtcgccatttatatgccg
atggtgccggaagccgcggtggcgatgctggcctgcgcccgcatcggcgccatccactca
gtgattttcggcggcttctcgccggaggcggtggccggacgcattatcgactccagctcg
cgcctggtgatcaccgctgacgaagggctgcgcgctggtcgcgccatcccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaacagtattgagcatgtcgtggtcctg
aaacgtaccggcggcaaaatcgactggcaggaaggccgcgacctgtggtggagcgacctg
atggcgaacgccagcgccgagcaccggcccgtcgagatgaacgccgaagatccgttgttc
atcctctatacctctggctccaccggtaaaccgaaaggggtgctgcacaccaccggcggc
tacctggtctacgcggccaccaccttcaaatacgttttcgactaccatccgggcgatatt
tactggtgcaccgccgatgtgggctgggtcaccggccacagctatctgctgtatggtccg
ctggcctgcggtgccaccaccctgatgttcgaaggggtgccgaactggccaaccccggca
cgtatgtgccaggtcgtcgataagcacaaggtcagcattctctataccgccccgacggct
atccgcgccctgatggcggaaggcgacaaagcgatcgaaggcacagaccgttcctcgctg
cgcattcttggctcggtcggcgaaccgattaacccggaagcctgggagtggtactggaag
aagatcggcaacgagaagtgcccggtgatggacacctggtggcagaccgaaaccggcggc
tttatgatcaccccgctgccgggcgcgatcgaactgaaggccggctccgcgacgcgtccg
ttcttcggcgtccagccggtgctggtggataacgaaggcctgccgctggatggcgccacc
gagggcaatcttgccatcgccgactcctggcccggccaggcgcgcaccctgttcggtgac
catgagcgctttgagcaaacctacttctccaccttcaaaaatatgtactttagcggcgat
ggcgcgcgtcgcgatgaagatggttactactggatcactggccgcgtggatgacgtgctg
aacgtctccggccaccgtctgggtaccgcggaaattgaatccgcgctggtgtcgcacccg
aaaatcgctgaagcggcggtggtggggatcccgcacaacatcaaaggccaggccatctac
gcctacgtgacgctcaatcacggcgaagaaccaacgccggagctgtatgccgaagtgcgt
aactgggtgcgcaaagagatcggcccgctggcgacgccggatgtgctgcactggaccgat
tcgctaccgaaaacccgctcgggcaaaatcatgcgtcgcattctgcgtaagattgccgcg
ggcgacaccagcaacctcggcgatacctcgacgctcgccgatcctggcgtcgtggaaaaa
ctgctcgaagagaagcaggccataacgatgccatcgtaa

DBGET integrated database retrieval system