KEGG   Klebsiella pneumoniae 342: KPK_5191Help
Entry
KPK_5191          CDS       T00772                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00010  Glycolysis / Gluconeogenesis
kpe00620  Pyruvate metabolism
kpe00640  Propanoate metabolism
kpe00680  Methane metabolism
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01130  Biosynthesis of antibiotics
kpe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_5191 (acsA)
   00620 Pyruvate metabolism
    KPK_5191 (acsA)
   00640 Propanoate metabolism
    KPK_5191 (acsA)
  Energy metabolism
   00680 Methane metabolism
    KPK_5191 (acsA)
Enzymes [BR:kpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KPK_5191 (acsA)
Lipid biosynthesis proteins [BR:kpe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KPK_5191 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACI08814
UniProt: B5XXT5
Position
5244444..5246402
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPANIAERCLINPEQYKAQYQQSITDPDTFWGEQGKILDWIRPYTRVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDASQSKHITYRELHADVCRF
ANALLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGLRAGRAIPLKKNVDDALKNPNVNSIEHVVVLKRTGGKIDWQEGRDLWWSDL
MANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVSILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPVLVDNEGLPLDGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacacaaacaccctattcccgctaatatcgcggaacgttgcctgattaac
ccggaacagtacaaggcgcagtaccaacaatccataaccgaccctgatacattttggggc
gagcagggcaagatccttgactggatacgcccctatacccgcgtgaagaacacctctttc
gcgccgggtaatatttccatcaaatggtatgaagatggcaccctgaacctcgccgccaac
tgcctcgaccgccatctcgccgagcgcggcgatcaaaccgccatcatctgggaaggcgac
gacgccagccagagcaagcacatcacctaccgtgaactgcatgcggacgtgtgccgcttc
gccaatgcgctgctcgaccttgggattaaaaaaggcgatgtggtcgccatttatatgccg
atggtgccggaagccgcggtggcgatgctggcctgcgcccgcatcggcgccatccactca
gtgattttcggcggcttctcgccggaggcggtggccggacgcattatcgactccagctcg
cgcctggtgatcaccgctgacgaagggctgcgcgctggtcgcgccatcccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaacagtattgagcatgtcgtggtcctg
aaacgtaccggcggcaaaatcgactggcaggaaggccgcgacctgtggtggagcgacctg
atggcgaacgccagcgccgagcaccggcccgtcgagatgaacgccgaagatccgttgttc
atcctctatacctctggctccaccggtaaaccgaaaggggtgctgcacaccaccggcggc
tacctggtctacgcggccaccaccttcaaatacgttttcgactaccatccgggcgatatt
tactggtgcaccgccgatgtgggctgggtcaccggccacagctatctgctgtatggtccg
ctggcctgcggtgccaccaccctgatgttcgaaggggtgccgaactggccaaccccggca
cgtatgtgccaggtcgtcgataagcacaaggtcagcattctctataccgccccgacggct
atccgcgccctgatggcggaaggcgacaaagcgatcgaaggcacagaccgttcctcgctg
cgcattcttggctcggtcggcgaaccgattaacccggaagcctgggagtggtactggaag
aagatcggcaacgagaagtgcccggtgatggacacctggtggcagaccgaaaccggcggc
tttatgatcaccccgctgccgggcgcgatcgaactgaaggccggctccgcgacgcgtccg
ttcttcggcgtccagccggtgctggtggataacgaaggcctgccgctggatggcgccacc
gagggcaatcttgccatcgccgactcctggcccggccaggcgcgcaccctgttcggtgac
catgagcgctttgagcaaacctacttctccaccttcaaaaatatgtactttagcggcgat
ggcgcgcgtcgcgatgaagatggttactactggatcactggccgcgtggatgacgtgctg
aacgtctccggccaccgtctgggtaccgcggaaattgaatccgcgctggtgtcgcacccg
aaaatcgctgaagcggcggtggtggggatcccgcacaacatcaaaggccaggccatctac
gcctacgtgacgctcaatcacggcgaagaaccaacgccggagctgtatgccgaagtgcgt
aactgggtgcgcaaagagatcggcccgctggcgacgccggatgtgctgcactggaccgat
tcgctaccgaaaacccgctcgggcaaaatcatgcgtcgcattctgcgtaagattgccgcg
ggcgacaccagcaacctcggcgatacctcgacgctcgccgatcctggcgtcgtggaaaaa
ctgctcgaagagaagcaggccataacgatgccatcgtaa

DBGET integrated database retrieval system