KEGG   Klebsiella pneumoniae 342: KPK_5279Help
Entry
KPK_5279          CDS       T00772                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00620  Pyruvate metabolism
kpe00630  Glyoxylate and dicarboxylate metabolism
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01200  Carbon metabolism
Module
kpe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPK_5279 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    KPK_5279 (aceB)
Enzymes [BR:kpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KPK_5279 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACI09795
UniProt: B5XYC9
Position
complement(5337997..5339598)
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGEQEKQILTPEAVEFLTELVSRFAPARNKLLAARQQQQQAIDQ
GVLPDFISETASIRKGNWTIRGIPADLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLQPNPAVLVCRVRGLHLPEKHVTWR
NEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQAWQEAAWWNDVFSFTEDRFDLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNRQVLSKVTADKELEANNG
HDGTWIAHPGLADTAMAVFNRVLGDKPNQLSVTRSADAPITAEQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLNDGTPVTKALFR
QWLAEELMVIQEELGEHRFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcaccgatgaactggcctttagtcagccctatggcgagcag
gagaagcagatcttaacgcctgaggcggtagaatttctgacggaactggtgagccgcttt
gcgccggcgcgtaataagctactggccgcgcgtcagcagcagcagcaggccattgatcaa
ggtgtacttcctgactttatttcggaaaccgcttccattagaaaaggaaactggaccatc
cgcggtatcccggcggatttgcaggatcgccgtgttgaaatcaccggtcccgttgaacgc
aaaatggtcattaacgcgatgaatgccaacgtcaaagtctttatggcggactttgaggat
tcgctggcgcctgactggcgtaaagtcattgatggccaaattaacctgcgtgatgccgtg
aacgggaccatcagctacaccaacgaggccggcaaaatctaccagctgcagcccaatccc
gctgtgctggtatgccgtgtgcgcggcctgcacctgccggaaaagcatgtcacctggcgt
aatgaggccatccccggcagtctgttcgattttgcgctctatttctttcataactaccag
gcgctgctggcgaaggggagcggtccctacttctatctgccaaaaacccaggcctggcag
gaggcggcatggtggaacgatgtctttagctttacggaagatcgctttgacctgccgcgc
ggcaccatcaaggccacgctgctgattgagacgctgccagcggtgttccagatggatgag
atcctgcatgcgctgcgcgaccatattgttggcctgaactgcggccgttgggactacatc
ttcagctatatcaaaacgctgaaaaaccatccggaccgcgtgttgcctgaccgtcaggtg
gtgacgatggataaaccgttcctcagcgcctactcacggttgttgattaagacctgccac
aaacgcggtgcgtttgcgatgggcggcatggcggcgtttatcccgagcaaagatgccgaa
cgtaaccgtcaggtgctgagcaaagtcaccgccgataaagagctggaggcgaacaatggt
cacgatggcacctggatcgcccacccggggctggcggataccgctatggcggtgtttaac
cgcgtactgggcgataagccgaatcagctctcggtcacccggagcgcggatgcgccaatt
accgccgaacagctgctggccccctgcgagggcgagcgcacggaagccgggatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaagcctggatctccggcaacggttgcgtcccg
atttatggcctgatggaagacgccgcgacggccgagatctcgcgcacctctatctggcag
tggatccatcatcagaaaaccctgaacgacggcaccccggtcacgaaggcgctgttccgc
cagtggctggcggaagagctgatggtgattcaggaggagctgggagagcaccgtttcagc
catggccgctttgacgatgcggcgcgactgatggagcagatcaccacctccgacgagcta
attgattttctgacattaccgggctaccgcctgctggcctga

DBGET integrated database retrieval system