KEGG   Klebsiella pneumoniae 342: KPK_5333Help
Entry
KPK_5333          CDS       T00772                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPK_5333 (fadB)
   01212 Fatty acid metabolism
    KPK_5333 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPK_5333 (fadB)
   00650 Butanoate metabolism
    KPK_5333 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    KPK_5333 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    KPK_5333 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPK_5333 (fadB)
   00310 Lysine degradation
    KPK_5333 (fadB)
   00380 Tryptophan metabolism
    KPK_5333 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPK_5333 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPK_5333 (fadB)
   00281 Geraniol degradation
    KPK_5333 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    KPK_5333 (fadB)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KPK_5333 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPK_5333 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KPK_5333 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     KPK_5333 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5396182..5398371
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQNDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALK
IGLVDGVVAAEKLRDGALAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETEAKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDKTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLADVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggttcggtcaacaagcttgataccgcaaccgtagccagcctcggt
cacgcgctggacgtactggaaaaacaaaacgatctcaaaggtctgctgctgcgctctgaa
aaagcggcgtttatcgtcggcgcggatatcaccgaattcctctcgctgttcctggtccct
gaggagcagttaagccagtggttgcattttgctaacagcgttttcaatcgtctggaagat
cttcccgtcccgacgatctctgccgtcaatggttacgcgctgggcggcggttgtgaatgc
gtcctggcgaccgattaccgcctggcgacgccggatctgcgtatcggtctgccggaaacc
aagcttggcattatgccgggcttcggcggttctgtgcgtctgccacgcttgctcggcgcc
gatagcgcgctggaaattattgccgccgggaaagacgtcggcgccgatcaggcgctgaaa
atcggcctggtggatggtgtggtcgcagcggaaaaactgcgtgacggcgcgctggcgatc
ctgcgtcaggcgattaatggcgatctggactggaaagcaaaacgtcagccgaaactggag
ccgctgaagctcagcaaaattgaagctaccatgagcttcacgattgccaaaggcatggtc
gcgcaaacggccgggaaacattacccggcgccgatcaccgcggtgaaaaccattgaagcc
gccgcgcgtcttggtcgtgaagaagccctggtgctggaaaataaaagctttgtcccgctg
gcccataccaatgaggcccgcgcgctggttggtatcttcctgaacgaccagtacgtcaaa
gcgaaagcgaaaaagttgaccaaagatgtcgagacgccgaagcatgctgctgtcctgggc
gctggcattatgggcggcggtatcgcataccagtcggcctggaaaggcgtgccggtggtg
atgaaagacattagcgacaaatcgctgaccctgggcatgaccgaagcggcgaaactgctg
aataaacagctggaacgcggcaaaatcgacggtctgaagctggccggagtgatcagcacc
attcagccaaccctggaatacagcggttttgatcgcgtcgacgtggttgttgaagcggtg
gtggaaaacccgaaagtgaagaaagcggtgctggccgaaaccgaggcaaaagtgcgcccg
gataccgtgctggcatccaacacctcaacaatccccatcagcgaactggcaagcgttctg
caacgcccggaaaacttctgcggtatgcacttctttaacccggtgcatcgcatgccgctg
gttgaagtgatccgcggcgaaaaaacctcggataagaccattgccaaagttgtggcctgg
gccagcaaaatgggcaaaacgccgatcgtggtgaatgattgtcccggcttcttcgtcaac
cgcgtgctgttcccctacttcgccggcttcagccagctgctgcgcgacggggcggatttc
cgcaaggtcgacaaagtgatggaaaaacagtttggctggccaatgggcccggcctatctg
ctggacgtggtcggcatcgataccgcccaccatgctcaggccgtgatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccatcgacgccctgtttgacgccaaccgt
ttcggccagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgctgccgtcgacagcctgctggccgacgtcagccagccgaagcgc
gatttcagcgatgaagagattatcgcccgcatgatgatcccgatggttaacgaagtcgtc
cgctgcctggaagaaggcattatcgccagcccggcggaagcggatatggcgctggtatac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggacaccatcggcagc
gcgaagtatctcgatatggcgcagcaataccagcaccttggcccgctgtatgaagtgcca
gccggtctgcgtgacaaagcgcgccataacgaagcgtattatccccaggtagagccagcc
cgtccggttggcgctctgaaaacggcttaa

DBGET integrated database retrieval system