KEGG   Klebsiella pneumoniae 342: KPK_5375Help
Entry
KPK_5375          CDS       T00772                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPK_5375 (hemD)
Enzymes [BR:kpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KPK_5375 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5442468..5443208
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEALVSRLRAMGRVAWSFPLIEFTPGRELPVLGDHLAHLGSDDLLFALS
QHAVEFAHARLQQQGLPWPTSPHYFAIGRTTALALHTVSGQHIRYPLDREISEVLLQLPE
LQNIAGKNALILRGNGGRELLGATLAERGARVTFCECYQRSAKHYDGAEEAMRWQSRGVT
TLVVTSGEMLQQLWSLIPQWYREQWLLHCRLVVVSERLALQARELGWQEIQVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcactcgtccactcccgcaaggggaagcgctggtcagccgtctgcgg
gccatgggacgcgtggcctggagctttccgctgatagaatttacgcctggccgggagctt
cccgtgctgggcgaccatcttgcccatctggggtccgacgacctgctgtttgcgctatcc
cagcatgcggtggaattcgcccatgcccgtctgcagcagcaaggcctgccctggcccact
tctccgcactattttgccattggtcgaacgacggcgctggccctgcatacggtcagcggg
cagcacatccgttacccgttagatcgggaaattagcgaagtcttgctacaattacctgaa
ttacaaaacattgccgggaaaaatgcgctgatcctacgcggcaatggtgggcgggaactc
ttaggcgccacgctggctgaacgcggcgccagggtcacattttgtgaatgttatcaacgt
agtgcaaaacattacgatggcgcagaagaagcgatgcgctggcagtctcgcggggtcacc
acgctggtggtcaccagcggtgagatgctgcagcagctgtggtcgctcataccgcaatgg
tatcgcgaacagtggctcctgcactgccgccttgtcgttgtcagcgaacgtctggccctt
caggcccgggaactgggctggcaggagattcaggttgccgataacgctgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system