KEGG   Klebsiella pneumoniae 342: KPK_5456Help
Entry
KPK_5456          CDS       T00772                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPK_5456 (pfkA)
   01230 Biosynthesis of amino acids
    KPK_5456 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_5456 (pfkA)
   00030 Pentose phosphate pathway
    KPK_5456 (pfkA)
   00051 Fructose and mannose metabolism
    KPK_5456 (pfkA)
   00052 Galactose metabolism
    KPK_5456 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    KPK_5456 (pfkA)
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPK_5456 (pfkA)
Protein phosphatases and associated proteins [BR:kpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KPK_5456 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5524953..5525915)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFIMVPEVEYTRDDLVAEIKAGIAKGKKHAIVAITEHMCDVDELASYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKNDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgcgccgggcatgaacgcagca
attcgtggcgttgtgcgcgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggattgtatgaagaccgtatggttcagctcgaccgttacagcgtttccgac
atgatcaaccgcggcggcaccttcctgggctccgctcgcttcccggaattccgcgaagaa
cacattcgcgctgtggctatcgaaaacatgaagaagcgcggcctggatgcgctggtggtt
atcggtggtgacgggtcctatatgggggcaatgcgcctgaccgagatgggcttcccgtgc
atcggtctgcccggcaccatcgacaacgatatcaaaggcactgactacaccatcggcttt
ttcaccgccctgagcaccgtggtggaagcgattgaccgtctgcgcgacacctcttcttca
catcagcgcatctccgtggtggaagtgatgggccgttactgcggcgacctgaccctggcg
gcggcgattgccggcggctgtgagttcatcatggtgccggaagtggaatacacccgtgac
gatctggtggccgaaatcaaagccggtatcgcgaaaggtaagaaacacgctatcgtggcg
atcaccgagcacatgtgcgacgttgacgagctggcaagctacatcgagaaagaaaccggg
cgtgaaactcgcgccaccgtcctcggccacattcaacgcggcggttccccggttccttac
gaccgcatcctggcttcccgcatgggcgcctatgcgattgagctgctgctgcagggccat
ggcggccgttgcgtcggcatccagaacgagaagctggtgcaccacgacatcatcgatgcc
atcgagaacatgaagcgtccgttcaagaacgactggctggattgcgcgaagaaactgtac
taa

DBGET integrated database retrieval system