KEGG   Klebsiella pneumoniae 342: KPK_5475Help
Entry
KPK_5475          CDS       T00772                                 

Definition
lactaldehyde reductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPK_5475
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_5475
  Lipid metabolism
   00071 Fatty acid degradation
    KPK_5475
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPK_5475
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPK_5475
   00626 Naphthalene degradation
    KPK_5475
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPK_5475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5543298..5544446
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVKLVAGKQWGKALIVTDGQLVKLGLLDSLFSALDKQQMA
YQLFDGVYPNPTEALVQQGYAAYQAARCDYLIAFGGGSPIDTAKAIKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSERQVKEVIIDPNLIPDIAVDDASVML
DIPPAVTAATGMDALTHAIEAFVSVGAHPLTDANALEAIRLINLWLPKAVDDGHDLQARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
RVAQAMGVDTRGMNDEAASMEAINAIRTLSKRVGIPQGFSQLGVSKADMEGWLDKALADP
CAPCNPRPASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagttttatgttggcactacctaaaatcagcctccacggcgcaggcgctatcggtgat
atggttaaactggtggccggtaagcagtggggcaaggcgctgatcgtcaccgacggtcaa
ctggtgaagctgggcctgctggacagtctgttttccgcgctggataaacagcagatggct
tatcagctgtttgacggcgtgtaccccaatcccaccgaagcgctggtgcagcaaggctat
gcggcgtaccaggcggcccgctgcgattacctgatcgccttcggcggcggcagcccgatt
gataccgccaaggcgataaaaatcctcaccgccaaccctggcccctccaccgcctactcc
ggcgtcggcaaagtgaaaaacgctggcgtgccgctggtggccatcaacaccaccgccggc
acggcggcggagatgaccagcaacgccgtgattatcgatagcgagcggcaggtaaaagag
gtgattatcgacccgaacctgatcccggatatcgccgtcgacgacgccagcgtgatgctc
gacatcccgccagccgttaccgccgccaccggcatggatgccctgacccacgccatcgag
gcctttgtctccgttggcgcccatcccctgaccgacgccaacgccctcgaggccattcgc
ctgatcaacctgtggctgccgaaagcggtagacgatggacatgatctgcaggcccgcgag
cagatggcctttggccagtatctggcgggcatggcgttcaacagcgccggtctcgggctg
gtacacgccctggcccatcagcctggcgctacccacaacctgccacacggagtgtgcaac
gccatcctgctgccgattatcgaaaactttaaccgtccgaacgcggtggcgcgcttcgcc
cgcgtagcgcaggcgatgggcgtcgatacccgcggcatgaacgatgaggctgccagcatg
gaggccatcaatgccatccgcacgctgagcaaacgcgtagggatcccccagggcttcagc
cagcttggcgtcagcaaagccgatatggaaggctggctggacaaagcgctggccgaccct
tgcgcgccatgcaacccgcgccccgccagccgcgatgaggttcgcgagctctatctggag
gccttatga

DBGET integrated database retrieval system