KEGG   Klebsiella pneumoniae 342: KPK_5489Help
Entry
KPK_5489          CDS       T00772                                 

Definition
(RefSeq) phosphofructokinase family protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPK_5489
   01230 Biosynthesis of amino acids
    KPK_5489
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_5489
   00030 Pentose phosphate pathway
    KPK_5489
   00051 Fructose and mannose metabolism
    KPK_5489
   00052 Galactose metabolism
    KPK_5489
  Energy metabolism
   00680 Methane metabolism
    KPK_5489
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KPK_5489
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPK_5489
Protein phosphatases and associated proteins [BR:kpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KPK_5489
Messenger RNA biogenesis [BR:kpe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KPK_5489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5554932..5555912)
Genome map
AA seq 326 aa AA seqDB search
MKIGIVISGGDVSGMNNFIFQVARQANADITLFNGGIPGLLEKSHQDMAWRDLVDFSITA
VPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMAGGDGSLQFLNTLSEFEINCFGVGM
TIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRALPGRVFMVEILGGYCGELTLQSAIK
CNADIALIPEAQMPLTMLAERITRKLSMQNSVVILCSEGYTKEYSPGFQGAIDTMIKQLE
PQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEVVRCIQSGMKNKAIIINSSNKPIPI
DLVSMKKRLVDTEGHHYKLAKQLNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcatcgttattagcggcggggatgtttcgggaatgaataattttatattc
caggtagccaggcaggctaatgccgatatcacgctgtttaatggcggtattccagggcta
ctggagaaaagtcatcaggatatggcgtggcgcgatctggttgatttctccattaccgcg
gtgccgatcattacctcggggcgaaccagtcgcaaactgcagcgcagtgaatatgaaagc
attgctaaaaaacttaaatctctgcgtattgatgtgctcattatggccgggggggatggc
agcctgcagtttctgaatacccttagtgaatttgagattaattgctttggtgtcgggatg
actatcgataatgatgtgtatggcagtgattatacgattggtttttccacggcctgtgag
caaattattaaagaagtctcccgtttaagaaataccggaagagcgctgccgggtcgggtt
tttatggttgagatattaggaggctattgtggagaactaacgttacagtccgccattaaa
tgtaatgctgatattgccctgatcccggaggcacagatgccgctgaccatgcttgcggaa
cggattacccggaagctgagcatgcaaaatagcgtcgtgatcctctgctcagaaggctat
accaaagagtactctcccggctttcagggggcgattgataccatgattaaacagctggaa
ccacaaataggtgtccgtatccgtaaaacgatcgtcggctatggtttacgcagcggtgat
ccaacctgtgaagagatttatcagggtaccattatggccagtgaagtggttcgctgtatt
cagtcaggtatgaaaaataaagccataataattaattccagtaacaaacctattccgatt
gatctagtcagtatgaaaaaacgtctggtcgatactgaaggacatcattataaacttgcc
aagcaactcaatattatttga

DBGET integrated database retrieval system