KEGG   Klebsiella pneumoniae 342: KPK_5489Help
Entry
KPK_5489          CDS       T00772                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00010  Glycolysis / Gluconeogenesis
kpe00030  Pentose phosphate pathway
kpe00051  Fructose and mannose metabolism
kpe00052  Galactose metabolism
kpe00680  Methane metabolism
kpe01100  Metabolic pathways
kpe01110  Biosynthesis of secondary metabolites
kpe01120  Microbial metabolism in diverse environments
kpe01130  Biosynthesis of antibiotics
kpe01200  Carbon metabolism
kpe01230  Biosynthesis of amino acids
kpe03018  RNA degradation
Module
kpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPK_5489
   00030 Pentose phosphate pathway
    KPK_5489
   00051 Fructose and mannose metabolism
    KPK_5489
   00052 Galactose metabolism
    KPK_5489
  Energy metabolism
   00680 Methane metabolism
    KPK_5489
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KPK_5489
Enzymes [BR:kpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPK_5489
Protein phosphatases and associated proteins [BR:kpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KPK_5489
Messenger RNA biogenesis [BR:kpe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KPK_5489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACI11664
UniProt: B5XZH3
Position
complement(5554932..5555912)
Genome map
AA seq 326 aa AA seqDB search
MKIGIVISGGDVSGMNNFIFQVARQANADITLFNGGIPGLLEKSHQDMAWRDLVDFSITA
VPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMAGGDGSLQFLNTLSEFEINCFGVGM
TIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRALPGRVFMVEILGGYCGELTLQSAIK
CNADIALIPEAQMPLTMLAERITRKLSMQNSVVILCSEGYTKEYSPGFQGAIDTMIKQLE
PQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEVVRCIQSGMKNKAIIINSSNKPIPI
DLVSMKKRLVDTEGHHYKLAKQLNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcatcgttattagcggcggggatgtttcgggaatgaataattttatattc
caggtagccaggcaggctaatgccgatatcacgctgtttaatggcggtattccagggcta
ctggagaaaagtcatcaggatatggcgtggcgcgatctggttgatttctccattaccgcg
gtgccgatcattacctcggggcgaaccagtcgcaaactgcagcgcagtgaatatgaaagc
attgctaaaaaacttaaatctctgcgtattgatgtgctcattatggccgggggggatggc
agcctgcagtttctgaatacccttagtgaatttgagattaattgctttggtgtcgggatg
actatcgataatgatgtgtatggcagtgattatacgattggtttttccacggcctgtgag
caaattattaaagaagtctcccgtttaagaaataccggaagagcgctgccgggtcgggtt
tttatggttgagatattaggaggctattgtggagaactaacgttacagtccgccattaaa
tgtaatgctgatattgccctgatcccggaggcacagatgccgctgaccatgcttgcggaa
cggattacccggaagctgagcatgcaaaatagcgtcgtgatcctctgctcagaaggctat
accaaagagtactctcccggctttcagggggcgattgataccatgattaaacagctggaa
ccacaaataggtgtccgtatccgtaaaacgatcgtcggctatggtttacgcagcggtgat
ccaacctgtgaagagatttatcagggtaccattatggccagtgaagtggttcgctgtatt
cagtcaggtatgaaaaataaagccataataattaattccagtaacaaacctattccgatt
gatctagtcagtatgaaaaaacgtctggtcgatactgaaggacatcattataaacttgcc
aagcaactcaatattatttga

DBGET integrated database retrieval system