KEGG   Klebsiella pneumoniae CG43: D364_01665Help
Entry
D364_01665        CDS       T02866                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D364_01665
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    D364_01665
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    D364_01665
Enzymes [BR:kpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     D364_01665
Exosome [BR:kpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D364_01665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361934..363358
Genome map
AA seq 474 aa AA seqDB search
MTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEALRA
SLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGK
PDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQDAT
PAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAETA
TAGEWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKASY
HGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAANP
CGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTHDG
AVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtgaaattaagcgccctgtttattgccctgattcctctactgggctcgccg
gttattcatgcagaaactactgctgcgccggttctggaaaatcgcgctgcgcaaggagat
atcaccactcctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctgcgcgcc
tcgctaatcaataagccagctaaaaacgttattctgctgattggcgatggcatgggtgat
tcggaaattaccgctgcgcgaaactatgccgagggggcgggcggtttctttaaaggaatt
gatgctctgccgttaaccgggcagtacacgcattattcgctggataaaaaaaccgggaaa
ccggactacgtgaccgactcggcggcctccgccaccgcctggaccaccggcgtgaagact
tataacggcgcgctgggcgtcgatattcatgagaatgcgcatcagaccatccttgagctg
gcgaaagcggcggggctggccaccggcaacgtttccaccgccgagctgcaggacgccacc
cccgcggcgttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggttaccagc
gaaaaatgccccagcaatgcgctggaaaaagggggcaaaggctccattaccgaacagctg
ctgaacgcccgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaaacggcg
acggcgggcgagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggctaccag
attgtgaccgacgcggcttctcttgccgccgcgacggaagccagtcaggataaaccgctg
ctgggactctttgccgatggcaatatgccggtacgctgggaagggccgaaggcgtcttat
cacggtaatatcgataagccgccggtgacctgtacgccaaacccgaagcgtgacgcctcg
gtgccgacgctggcgcagatgaccgagaaagcgattgacctgctgagtcgcaacgagaaa
ggtttcttcctgcaagtcgaaggcgcatccatcgataagcaggaccatgcggccaatccg
tgcggccagatcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctggaattc
gcgcgaaaagacggtaataccctggtgatcgtcaccgccgaccatgcgcatgccagccag
atcatcccggcggatagcaaagccccggggctgacccaggctctgaacacgcacgatggc
gcggtgatggtgatgagctacggcaactctgaggaagagtcgatggagcacaccggcacc
caactgcgcattgcggcctacggtccgcatgcggctaacgtcgtcggcctgaccgatcag
accgacctgttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system