KEGG   Klebsiella pneumoniae CG43: D364_08360Help
Entry
D364_08360        CDS       T02866                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
kpi00220  Arginine biosynthesis
kpi00250  Alanine, aspartate and glutamate metabolism
kpi00471  D-Glutamine and D-glutamate metabolism
kpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D364_08360
   00220 Arginine biosynthesis
    D364_08360
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D364_08360
Enzymes [BR:kpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     D364_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGX37817
Position
1752781..1753707
Genome map
AA seq 308 aa AA seqDB search
MATVINNAMLEAILAEIRPLIGRGKVADYIPALASVSGDKLGIAISTVDGQHFAAGDAHE
RFSIQSISKVLSLVVAMNHYQEEEIWQRVGKDPSGQPFNSLLQLEIEQGKPRNPFINAGA
LVVCDMLQSRLSAPRQRMLEIVRRLSGVADIAYDPVVARSEFEHSARNAAIAWLMKSFGN
FHNDVATVLQNYFHYCSLEMSCVELARTFLFLADRGIAPHLDAPVIAPIQSRQVNALMMT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPQEMAIAVWSPELDDAGNSLAGVAMLEKLT
QRMGRSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacggtaatcaataatgcaatgctggaagccattctggcagaaatcaggccgctg
attggccgcggaaaagtggcggattatattccggcgctggccagcgtcagcggcgacaag
cttggtatcgcgatcagtacggtggacggtcagcactttgccgctggcgatgcccatgaa
cgtttttccatccagtcaatctccaaggtattgagcctggtggtggccatgaaccactat
caggaggaggagatctggcagcgggtggggaaagatccttccggccagccctttaactcg
cttctgcagctggagatcgagcagggcaaaccgcgcaacccgtttatcaacgccggggca
ctggtggtctgcgacatgctgcagagccggctcagcgccccgcgtcagcggatgctggag
attgtccgccgtctgagcggcgtggccgatatcgcctacgatccggtggtggctcgctca
gagtttgagcattcggcgcgcaacgccgccatcgcctggctgatgaaatcctttggtaac
ttccataacgacgtcgccaccgtgctgcagaactatttccactactgttcgctggagatg
agctgcgttgagctggcgcgaacctttctgtttctcgccgaccgcggcattgccccgcat
ctcgacgcgccggttattgcgcccatccagtcccgccaggtgaatgccctgatgatgacc
agcggcatgtaccagaatgctggtgaattcgcctggcgcgttggcctgccggcgaaatcg
ggcgtcggcggcgggatcgtggcgattgtcccgcaggagatggcgatcgccgtgtggagc
ccggagcttgacgacgccgggaactcgctggccggcgtggcgatgctggaaaaactgact
cagcggatggggaggtcggtgttctga

DBGET integrated database retrieval system