KEGG   Klebsiella pneumoniae CG43: D364_08855Help
Entry
D364_08855        CDS       T02866                                 

Definition
RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kpi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D364_08855
Enzymes [BR:kpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     D364_08855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1847821..1848693
Genome map
AA seq 290 aa AA seqDB search
MRVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAAT
GNDSNGAWIRQQIKNEPLTLLPDGHFNQHSDTSIILNSADGDNAIITTTAAADTFSLDEM
IPHMADAVAGDILLQQGNFSLDKTRALFQYARSRGMTTVFNPSPVNPDFCHLWPLIDIAV
VNESEAELLQPYGVKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVMLA
SALLRGVAPDALALAHASRAAAITVSRRGTLSAFPGSRELAALLTTDGAR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtttacgttactggtaatattaccgtagatgaaacctggtccattccggatata
ccgaaaaaaggagcctccattcacggcgttaaagtgtcgcaggatatcggcggtaaaggc
gcgaaccaggcgattatattatcccgctgcggaatagagacgcgtttaattgccgccacg
ggaaatgacagcaacggcgcgtggatccgccagcagataaaaaatgaaccactgacgcta
ctacccgacggccatttcaatcaacatagcgatacctcgattattttaaatagcgctgat
ggcgacaacgccatcattaccactacggcggcggccgatacattcagcctggatgaaatg
attccgcatatggcggatgccgtcgctggcgatattctgctacagcagggcaatttctcc
ctcgataaaacgcgggcgctgttccagtacgccagaagccgcggcatgacgacggtattc
aacccctcacctgtcaatcctgacttttgccatctgtggcccctcatcgacatcgcggtg
gtcaatgaatccgaggccgagttgctccagccatacggggtgaaaaccttagtgattacc
cagggcgccgcaggcgcctggctggtccaggagggccagcgtcagttttgtcccgccgtg
cccgccgaggcgcttgatactaccggcgcgggcgacacgttcctcgccgtcatgttggcc
tccgccctgctgcgcggcgtcgcgccggatgcgctggcgctggcgcacgccagtcgcgct
gccgccattacggttagccgccgggggacgctcagcgcgtttcccggcagccgtgagctc
gccgccctgttaaccacggacggggcgcgctga

DBGET integrated database retrieval system