KEGG   Klebsiella pneumoniae CG43: D364_09425Help
Entry
D364_09425        CDS       T02866                                 

Definition
glycosidase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1959920..1961545)
Genome map
AA seq 541 aa AA seqDB search
MQREEWFHRAVIYQVDSSLFYDANGDGFGDLAGIRQKLHYIRSLGATVLWLTPFYLTPLQ
DDGYDISDHLQPDPRFGTIADVIELIARARELGLRVIVELVIQHTSAQHPWFQAARRDPR
SPWRPYYLWADRPPENDDPPMFPGVEESVWRWDEQAGQYYRHMFYHHEPDLNLAHPPVIA
EIENIITFWLQAGVSGFRLDAASHLVKQAGKGDETRGYPLLTHLRQVVQRLNPDAILLGE
VDVAVEDYRHYFGQGDRLQMVLNFWLNKYLYLSLAQQRAAPVVKALQAMVTPPDGCCFVN
WLRNHDELDLEGIGERNKRQVIRTFAPDKSMSVYQRGVRRRLAPMLDGDTRRIALAHAIL
LALPGVPVMRYGDEIGMGDDLSLPERYAVRTPMQWSAAANAGFSRAARDDLPVKPVASGR
FRYQRINVETALRHPRSLLHRVRNMVLARTEYTEPGSLPFTLLTLKPDAVLGLLYRSESR
EVLMLANCSQQAVEVLLPPLAEGYWSPILEDKLYQDGLHGGKDARLALSGYGYRWFSRSL
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgggaagagtggtttcacagagcggtcatctatcaggttgacagttcgctcttt
tatgatgccaatggcgatggttttggcgatctcgcgggcattcgccaaaagctacactac
attcgcagcctcggagcgacggtgctctggctgactccgttctatctcactcctctgcag
gatgatggctatgatatcagcgatcatctgcagcccgatccgcggttcggcactatcgct
gacgtgattgagctgattgcccgcgcccgcgagctgggactgcgggtgatcgttgagctg
gtgatccagcacacctccgcgcagcacccgtggttccaggcggcgcgacgcgatccccgg
tcgccgtggcggccgtattatctgtgggccgatcggccgccggaaaacgacgatcctccc
atgtttcccggcgttgaggagagcgtctggcgctgggacgaacaggctgggcaatattat
cgccacatgttttatcaccacgagcccgacctgaatctcgcccatccgccggtgatcgct
gaaatcgaaaacattatcaccttctggctgcaggctggggtgtctggctttcgtctcgat
gccgcgtcacatctggtcaagcaggccggaaagggcgacgagacgcgcggctacccgctg
ctgacccatctccggcaggttgtacagcgcctcaatcccgatgcgatactcctgggtgaa
gtggacgtcgcggtagaagattaccgtcattatttcggccagggcgatcggctgcagatg
gtgcttaatttctggcttaacaaatacctctacctcagcctggcgcagcagcgcgccgcg
ccggtggtgaaggccctgcaggcgatggtgaccccgccggacgggtgctgcttcgtcaac
tggctgcgcaaccatgatgaactggatcttgaggggattggcgagcgcaacaagcgccag
gttatccgcacctttgcccctgataaatcgatgtccgtttaccagcgcggcgtacgccga
agactggcgccgatgctggacggcgatacccgacgcatagcgttagcccatgctatcctg
ctggcgctgcccggcgtgccggtgatgcgctatggcgacgagattggcatgggtgatgat
ctctccttaccggagcgctacgcggtcagaacgccgatgcagtggtcggccgcggccaac
gccggcttttcccgggcggcgcgggatgatttgccggtaaaaccggtggccagcgggcgg
ttccgctaccaacggatcaatgttgaaacggcgctgcgccatcccaggtcgctgctgcat
cgggtacgcaatatggtattggcgcgcacggaatatactgaaccgggatccctccctttt
actctccttaccctaaagcccgacgcggtgctgggcttgctctatcgcagcgaatcgcgg
gaggtactgatgctggccaactgcagccagcaggcggtagaggtcctgctcccgccgctg
gccgagggctactggagcccaattctggaagataagctctatcaggatgggctgcacggc
gggaaagatgcgcggctggcactctccgggtatggttaccgttggttcagccgcagcctg
agttag

DBGET integrated database retrieval system