KEGG   Klebsiella pneumoniae CG43: D364_12300Help
Entry
D364_12300        CDS       T02866                                 

Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2553222..2554709
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPTGGELWPEVEALAPSLNEIGINMVWLPPAYKGASGGYSVGYDTYD
LFDLGEFDQKGSVATKYGDKAQLLAAINALKEHNIAVLLDVVLNHKMGADEKEALRVQRV
DEQDRTQIDEEIIECEAWTRYTFPVRAGQYSQFVWDYKCFSGIDHIENPTEDGVFKIVND
YTGEGWNEQVDDELGNFDYLMGANIDFRNHAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKAWIEHVQEVAPQPLFIVAEYWSHEVEKLQQYIDLVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYADLFGASYEDTGGDGETYAIEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCI
AFSRSGTDDDPGCVVIMSNGDEGEKTLTLGENYGNKRWRDFLGNREEIVETDGEGCATFT
CNGGSVSVWVLEEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccttattgcaatgttttcactggtactaccccaccggcggcgagctg
tggcctgaggtcgaagcactggcgcccagcctgaatgaaatcggcatcaatatggtctgg
ttgccacccgcctacaaaggcgcctcgggcggttactccgtcggctatgatacctacgat
ctctttgacctcggcgagtttgatcaaaaagggtctgtcgccaccaaatatggcgacaaa
gcgcagttgctggcggcgatcaacgccctgaaggagcacaatatcgccgtgctgctggat
gtggtgctcaaccataaaatgggcgctgatgaaaaagaggctctgcgcgttcagcgcgtc
gatgagcaggatcgtacgcaaattgacgaggagatcattgagtgcgaggcatggacgcgc
tacaccttcccggtgcgcgccggacagtattcgcagtttgtctgggactacaaatgtttt
agcggcattgaccacatcgagaacccgacggaagacggtgtgtttaaaatcgtcaacgat
tacaccggcgaaggctggaatgaacaggtcgatgatgagctcggcaactttgactatctg
atgggcgccaatatcgatttccgcaatcatgcagtgaccgaggagatcaaatactgggcg
cgctgggtaatggagcagaccggctgcgacggttttcgtcttgacgcggtcaagcatatc
cccgcctggttttataaagcgtggatcgagcatgttcaggaggtggccccgcagccgctg
tttattgtagcggaatactggtcccatgaagtggagaagctccagcagtatatcgacctg
gtcgagggcaaaacgatgctgtttgatgccccactgcagatgaagtttcatgaagcgtcg
cgccagggccgcgattatgacatgagccagattttcagcgggacgctggtggaagccgac
cctttccatgccgtcactctggtcaccaatcatgatacgcagccgctgcaggccctcgag
gcgccggttgaaccctggttcaagcccctcgcctatgcgctgatcctgctgcgggagaat
ggcgtgccctcggtcttttatgccgatctcttcggcgcttcctatgaggataccggcggc
gacggagagacctatgccattgagatgcccgttatcgaacaactccacgagctgatcgac
gcccgtcagcgttttgcccatggcgtgcaaaccctttggttcgatcatcctaactgcatc
gcctttagtcgtagcggtactgacgacgatccaggctgcgtggtgatcatgtccaatggc
gatgagggcgaaaagacgctgacgctgggcgaaaactatggcaacaaacgctggcgggat
tttctcggtaaccgggaagagattgtcgaaaccgatggcgaaggctgcgcgacctttaca
tgtaacggggggagcgtgagcgtgtgggtgttagaggaggtattgtag

DBGET integrated database retrieval system