KEGG   Klebsiella pneumoniae CG43: D364_20120Help
Entry
D364_20120        CDS       T02866                                 

Gene name
malS
Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4188134..4190167
Genome map
AA seq 677 aa AA seqDB search
MKLAALATLFVPGMAFAAWTTTDFPAFTEEGTGRFISQKVVEKGTRPLQLNFDQQCWQPS
GGIKLNQMLSMEPCRGTPPQWRIFRQGLYTLEVDTRSGTPTMIISLEEKETSAAAPQIRQ
CPKWDGKPLTIDVSKTFAEGSKVRDFYSGNVATVSGGKITLQPAFGSNGLLLLERAETAA
PAPFDWHNATVYFVLTDRFVNGNPANDNSYGRHKDGMQEIGTFHGGDLQGLTSKLDYLQQ
MGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYTQDWSKLDANMGTEADLRRLVDEA
HKRGIRILFDVVMNHAGYATLADMQEFQFGSLYLQGDELKKTLGERWTDWKPGAGQTWHS
FNDYINFSDKAGWEKWWGKKWIRTDIGDYDNPGYDDLTMSLAFLPDLKTESKEVSGLPNF
YNHKPDTAAKAIPGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVEMDAWQQLKTQATAA
LAEWKKANPDKALDAAPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQDQAAKAATCMAN
IDLTWQQMADKLQSFNVLSYLSSHDTRLFREGGTTAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSEMNWQDVNGKAARSVTHWQKIGQFRARHPAIGMGKQTTLSMPRGYGFV
RESGEDKVMVIWAGQQQ
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgctgcgcttgccacgttattcgtgcctgggatggcctttgccgcctggact
accaccgactttcctgcttttaccgaagaagggaccggccgattcatcagccagaaagtg
gttgagaagggtacacgtcccctgcagctaaattttgaccagcagtgctggcagccttcc
ggcggtattaagctcaaccagatgctgtccatggagccctgtcgcggcacaccgccgcaa
tggcgcatcttccgccagggtctgtataccctggaggtggatacccgttccggcacgcca
acgatgataatttcgctggaggaaaaagagaccagcgccgcggcgccgcagatccgccag
tgtccgaagtgggacggaaaaccgctgaccatcgacgtcagcaaaaccttcgccgagggc
agcaaggtccgcgatttctacagcggcaatgtcgcgaccgtcagcggcggcaaaatcacc
ctgcagcccgccttcggcagcaatggcctgctgctactcgagcgtgccgagaccgccgcc
ccggcgccgtttgactggcacaatgccaccgtctacttcgtcctgaccgatcgcttcgta
aacggtaacccggccaacgacaacagctatggtcgccataaagacggcatgcaggagatc
ggcaccttccacggcggcgacctgcagggattaaccagcaagctggattatctgcagcag
atgggagttaacgccctgtggatcagctccccgctcgagcagatccacggctgggtcggc
ggcggcacgaagggcgatttccctcactacgcctaccacggctattacacccaggactgg
tcgaaactggacgccaacatggggaccgaagcggatctccgccgactggtggatgaagcg
cataagcgcggaatacgtattctgttcgacgtggtgatgaaccatgccggctacgccacc
ctggccgacatgcaggagttccagttcggctccctgtatctgcaaggagatgagctgaaa
aaaactctcggcgagcgctggacggactggaagccgggcgcgggacagacctggcacagc
tttaacgactatatcaacttcagcgacaaagccgggtgggagaaatggtggggtaagaag
tggatccgcaccgatatcggcgattacgacaatccgggctatgacgatctcaccatgtcg
ctggccttcctgccggacctgaaaaccgaatcgaaggaggtctcaggcctgccgaacttc
tataaccataaaccagacaccgcagcgaaagcgatcccgggctatacgccgcgcgactat
ctgacacactggctgagccagtgggtacgtgactacggcatcgatggcttccgcgtcgat
accgccaaacatgtggagatggacgcctggcagcagttaaaaacccaggccaccgccgcg
ctggcggagtggaagaaagccaatccggataaagcgctggatgcggcgccgttctggatg
accggcgaagcgtggggacatggagtgatgcagagcgattattatcgccacggttttgat
gcgatgatcaatttcgactaccaggaccaggcggcgaaagcggcgacctgtatggccaat
attgacctcacctggcagcaaatggcggacaagctgcagagctttaacgtcctgagctac
ctctcctcgcacgatacgcggctgttccgcgaaggcggcaccaccgcggcggagctactg
ctgctggcccctggcgccgtgcagattttctatggcgacgaatcatcgcgcccgttcggc
cccaccggctcggacccgctgcagggtacccgctcggagatgaactggcaggatgtcaac
ggcaaggcggcccgcagcgttacccactggcagaagatcggccagttccgcgctcgccat
ccggcaatcggcatgggcaaacagacaacgctgtcgatgccacgtggttacgggttcgtg
cgtgagagcggtgaagacaaagtgatggtcatctgggccgggcagcagcagtaa

DBGET integrated database retrieval system