KEGG   Klebsiella pneumoniae CG43: D364_20325Help
Entry
D364_20325        CDS       T02866                                 

Definition
5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:kpi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    D364_20325
Enzymes [BR:kpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     D364_20325
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     D364_20325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4231468..4232277)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDVPVLSVRRRAKYLL
LELPDGWIIVHLGMSGSLRILSEELPAEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTRTL
EGHPVLAHLGPEPLSDAFNADYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFSAG
IHPDRLASSLSREECEQLVKVIKLVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRICGTPVVGTKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaccagccgtcgcggcatcgagccgcacctggttggc
gcaaccattctgcacgccgtcgtgcgcaacggacggctgcgctggccggtttccgaagag
atctatcgcctgagcgacgttccggttctcagcgtgcgtcgccgcgccaaatacctgctt
ctggagctgccggacggctggatcatcgtccatcttgggatgtcggggagcctgcgcatc
ctgagcgaagagctgcctgctgaaaaacacgatcacgttgacctggtcatgagtaacggc
aaggtgttgcgctacaccgatccacgccgctttggcgcctggttgtggaccagaacgctg
gaaggccatccggtactggcccatcttggcccggagccgctcagcgacgcgttcaacgcc
gactatctccagcaaaaatgcgcgaagaagaaaaccgcgatcaaaccctggctgatggat
aacaagctggtggtgggcgtggggaatatctacgccagtgaatcgctgttctccgccggg
atccatcctgaccggctggcgtcctcgctgtcgcgggaagagtgtgagcagctggtgaag
gtgattaagctggtcctgctgcgttcgatagagcagggcggcaccacgttaaaggatttc
ctgcaaagcgatggcaagccgggctacttcgcccaggagctacaggtctatggccgcaag
ggcgaaccctgccggatctgcggcacgccggtcgtcgggaccaaacatgcccagcgggcg
accttttattgccgtcagtgccagaagtag

DBGET integrated database retrieval system