KEGG   Klebsiella pneumoniae CG43: D364_24685Help
Entry
D364_24685        CDS       T02866                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    D364_24685
Enzymes [BR:kpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     D364_24685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5145149..5146471
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYANYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTEMARLGDRVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEITPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcaggcattaagcgatgaa
gagatccgctttttcatcaacggcatccgcgacaatactatctctgaagggcagatcgcc
gcgctggcgatgaccatcttcttccacgatatgtctatgccggagcgcgtttcgctgacc
atggcgatgcgggattccggtaccgttctggactggaaaagcctcaaccttaacggtccg
atcgtcgataaacactctaccggcggcgtcggggatgtcacttcgctgatgctggggccg
atggtggccgcctgcggtggttacgtaccgatgatctccggccgcggcctcggccatacc
ggcggtacgctggacaaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgcttccgcgagattattaaagatgttggcgtggcaattatcgggcagaccagctccctt
gccccggccgacaaacgtttctatgccacccgcgatattaccgcgacggtggactccatc
ccgctgattaccgcctcgattctggcgaagaagctggcggaagggctggatgcgctggtg
atggacgtcaaagtcggcagcggcgcgtttatgccgacttatgaactctctgccgcgctg
gccgaagcgatcgtgggtgtcgccaacggcgccggcgtgcgcaccaccgcgctgctgacc
gatatgaatcaggtactggcctccagcgccggcaacgccgttgaagttcgcgaagcggtg
cagttcctgaccggcgaataccgcaacccgcgcctgttcgacgtgacaatggcgctgtgt
gtggaaatgctgatctccggcaagctggcggcggacgatgccgaggcgcgcgcgaagctg
caggcggtgctggataacggtaaagcggcggaagtgtttggccgcatggtcgcggcgcag
aaagggccgagcgactttgtcgagaattatgctaattatctgccgacggcgatgctgagc
aaagcagtctatgctgataccgaaggttttatcagcgcgatggatactcgcgcgctgggc
atggcagtggtttctatgggcggcggccgccgtcaggcatcggacaccattgactatagc
gttggctttaccgagatggcgcgtctgggtgaccgcgtcgacggacagcgtccgctggcg
gtgatccatgccaaagacgagaacagctggcaggaggccgcgaaagcggtcaaagcggcc
attaaactggacgataaagccccggaaattacgccgacagtctatcgccgtatcactgaa
tag

DBGET integrated database retrieval system