KEGG   Klebsiella pneumoniae JM45: N559_0220Help
Entry
N559_0220         CDS       T02799                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:kpj00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kpj00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
224944..226278
Genome map
AA seq 444 aa AA seqDB search
MEFSMQTYFDQLDRVRYEGPKSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNG
ADMFGVGSFDRPWQQPGDALEMAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYS
NNFARMVEVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNA
THQLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFKGTLLIEPKPQ
EPTKHQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVD
ANRGDPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGH
IGAMDTMALSLKVAARMIEDGELDKRVARRYAGWNGELGQQILNGQMTLSDIAQYAAQHQ
LAPQHRSGQQEQLENLVNHYLFDK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagttctctatgcagacctatttcgatcaactcgatcgcgttcgttacgaaggcccg
aaatccactaacccgctggctttccgtcattacaacccggatgaactggtgctgggcaaa
cggatggaagatcatctgcgttttgcggcctgttactggcacaccttctgctggaatggc
gccgatatgtttggcgtgggctcctttgatcgtccctggcagcagcctggcgacgccctg
gagatggccaaacgcaaagccgatgtggcgttcgaattcttccataaactcaacgtgcct
tactactgcttccacgacgttgacgtctcgccggaaggcgcttcgctcaaggagtacagc
aataacttcgcccggatggtcgaggtgctggctgagaaacagcagcagagcggcgtgaag
cttctgtgggggaccgcaaactgctttaccaacccgcgctacggcgccggcgcggccacc
aacccggatccggaagtatttagctgggcggccacccaggtggtcaccgccatgaatgcc
acccatcaactgggcggtgaaaactatgtgctgtggggcggtcgcgagggctatgaaacc
ctgctgaataccgacctgcgccaggagcgtgagcagattggccgctttatgcagctggtg
gtggagcataagcataaaatcggctttaaaggcacgctgctgattgagcccaaaccgcag
gagccgaccaagcatcagtatgactatgatgcctctaccgtttacggcttcctcaaacag
tttggtctggaaaaagagattaaactgaatattgaagctaaccatgccacgctcgccggc
cattcgttccatcatgaaattgcgacggccattgcgctggggctgttcggctccgttgac
gccaaccgcggcgatccgcagctgggctgggataccgaccagttcccgaacagcgtcgaa
gagaacgcgctggtgatgtatgaaatcctcaaagcgggcggcttcaccaccggcgggctc
aactttgatgcgaaagtgcgccggcagagcaccgacaaatacgatctgttctatggtcat
attggcgcgatggataccatggcgctatcgctgaaggtcgcggcgcggatgattgaggac
ggcgaactggataagcgcgtggccagacgctacgccggctggaacggtgagctggggcag
cagatccttaacgggcagatgaccctgagcgatattgcccagtatgccgctcagcatcag
ctggcgccgcagcatcgcagcggccagcaggaacaactggaaaacctggtcaaccattat
ctgtttgacaagtaa

DBGET integrated database retrieval system