KEGG   Klebsiella pneumoniae JM45: N559_0356Help
Entry
N559_0356         CDS       T02799                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N559_0356
Enzymes [BR:kpj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     N559_0356
Exosome [BR:kpj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N559_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378072..380258
Genome map
AA seq 728 aa AA seqDB search
MSNHIDRDVINALIAGHFADPFSVLGMHRTDAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDSRGFFSGVLPRRKNAFRYQLAVTWHGQQNLIDDPYRFGPLLQDLDVWLLSEGTHLR
PYETLGAHAATMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRFRKESGIWELFVP
GAHNGQLYKFELIDAHGNLRVKADPYAFESQMRPESASLICDLPPKVEQPADRRAANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPADDFALASFDGTSLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKAG
EWIPNEYGGRENLEAIEFLRNTNRILGEQTPGAVTMAEESTDFTGVTRPPAGGGLGFWFK
WNLGWMHDTLDYMKLDPVHRRYHHDKMTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDVSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFVFVRRDRAGNEIIVASNFTPV
PRHDYRFGINQPGRWREALNTDSMHYHGSNQGNGGVVESDAIASHGREHSLSLTLPPLAT
IWLVREAQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcatattgatagagacgtgattaatgcgctaatcgccggtcatttcgcggat
cccttttccgtgctcggcatgcaccgtactgacgccgggctggaagtgcgcgcattatta
cccgatgccaccgacgtgtgggttattgaaccgaaaaccggacgcaaagtcggcaagctc
gaatgtctcgactcgcgtggtttcttcagcggcgtcctgccgcggcgtaaaaacgctttt
cgctatcagctggccgtcacctggcacgggcagcagaatctgatcgatgacccttatcgc
tttggtccgctgttgcaggaccttgacgtctggctgctgtcggaagggacccacctgcgc
ccttacgaaacgctgggcgcgcacgctgccaccatggacggcgtcaccggtacccgtttc
tcggtgtgggcaccgaacgcccgccgcgtatcggtggtggggcagtttaactactgggat
ggccgtcgccacccgatgcggtttcgcaaagagtccgggatctgggagctgttcgttccc
ggcgcgcacaatggccagctgtataaattcgaactgattgacgcccacggcaatctgcgg
gtcaaagccgacccttacgcctttgagtcgcaaatgcgtccggaaagcgcctcgcttatc
tgcgatctgccgcccaaagtggaacagccagcggaccgtagagcggcgaaccagtttgat
gccccgatctctatctatgaagtgcatctcggctcctggcgccgtcataccgataataat
ttctggctgagctaccgcgagctggccgaccagctggtgccctatgcgaaatggatgggc
ttcacccatctcgaactattgccggttaacgagcacccgttcgacggcagctggggctat
caacccaccgggctctatgcgccgacccgccgcttcggcacccgcgacgatttccgttac
tttatcaatgccgcgcacgccgccgggctgaacgtcattcttgactgggtgcccggccac
ttcccggcggatgattttgcccttgcctcgtttgacggcacttcgctgtatgagcacagc
gatccgcgcgaggggtatcaccaggactggaataccctgatctacaactacggacgtcgg
gaagtcagcaactacctggtgggtaacgcgctgtactggatcgaacgcttcggcatcgat
gcgctgcgggtcgacgcggtggcctcgatgatctatcgcgattatagccgcaaggcggga
gagtggatccccaacgaatacggcggtcgggagaatctggaagccattgagtttctgcgc
aacaccaaccgcatccttggcgaacagactccgggcgcggtcaccatggcggaagagtcc
accgattttaccggggtgacccgtccgccagccggcggcggcctcggtttctggttcaaa
tggaacctcggctggatgcacgacaccctggattacatgaagctcgatccggtgcatcgc
cgctaccatcacgacaaaatgaccttcggcatgctctacaactacaccgagaattttgtg
ctgccgctctcccacgatgaagtggtgcacggcaaaaaatcgattctcgaccgcatgccg
ggcgatgcctggcagaagttcgccaacctgcgcgcctactacggctggctgttcgccttc
ccggggaaaaagctgctgtttatgggcaatgagttcgctcagggccgcgagtggaaccat
gacgttagcctcgactggcatctgctggagggcggcgacaactggcaccacggcgtccag
cggctggtgcgcgacctgaaccatacctaccggcatcataaagcgctgcacgagctggat
tttgacccctacggcttcgaatggctggtggtcgacgaccatgagcgctcggtgtttgtc
tttgtacgccgtgaccgggcgggcaacgagattatcgtcgccagcaacttcacgccggtg
ccgcgccacgactaccgcttcggcattaaccagccgggccgctggcgcgaggcgctaaat
accgactccatgcactatcacggcagcaatcagggcaatggcggcgtggtggaaagcgac
gctatcgccagccatggccgcgaacattcgctgtcgctgaccctgcccccgctggcgacg
atctggctggtccgggaggcgcaatga

DBGET integrated database retrieval system