KEGG   Klebsiella pneumoniae JM45: N559_0368Help
Entry
N559_0368         CDS       T02799                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397868..399961
Genome map
AA seq 697 aa AA seqDB search
MESKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRSTAATKVAVNPLPNVKI
FTHGKKMSLPVAGRGEYQWILTTEDGKQYQGKTRGGETLPLPAKLPEGYHSLTLTQEGER
WHCRTIVAPARCYEPQPLKEGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
SFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWQSPATQQ
ALQAARETDDVDYTAVTTLKMTALRMAWKQFSRREDEQMTAFREFVLREGESLYWQAAFD
ALHAWQVQQDPLRWGWPAWPKAFQDIDSPEVKAFCVEHEDDVSFYLWLQWLAWSQFAACW
ETSQRDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SLLALESQRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFESDAEKTFRAPALYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGC
LPKRAGHKASLMSMTGILNRGMQRYIADSNSALLGLQPEDWLEMATPVNIPGTSTEYPNW
RRKLSVTLEQMFADERVNKLIKDLDKRRKAASKKAAS
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgcctcgataatgccgcgctggcggcgggcatcagccccagctatatc
aacgcgcacggcaagccgcagtctatcgcggctgtcaccaaacagcgcctgctggatgcg
atgcatcgctctaccgccgccacgaaagtggcggttaacccgctgccgaacgtgaaaatt
ttcactcacggcaaaaaaatgtcgctgccggtggcaggacgcggtgagtatcagtggatc
ctgactactgaggacggtaagcagtatcaagggaaaacccgcggcggcgagacgctgccg
ctgccggccaaactgccggaggggtaccactccctgaccctcacccaggagggggagcgc
tggcactgccgaactatcgtcgcgccagcgcgctgctatgagccgcagccgctgaaagag
gggaaaaagctgtggggcacctgcgtgcagctgtataccctgcgctcagagaaaaactgg
gggatcggcgattttggcgatctgcgggccatgctgccggaaatcgcccgccgcggcggg
tcgtttattggccttaacccgattcatgccctctatccggcgaacccggagagcgccagc
ccctatagcccgtcttcacgtcgctggctgaacgttatttatatcgacgtcaacgcggtt
gaagatttccagcgtagcgaagaggcgcaggcgtggtggcagtctccggcaacgcagcag
gcactgcaggcggcgcgggaaacggacgatgtggattataccgccgtcactacgctgaaa
atgaccgcgctgcgtatggcgtggaaacaattctctcgtcgtgaagatgagcagatgaca
gcgttccgcgagtttgttctgcgcgaaggggaaagcctctactggcaggcggctttcgat
gcgctgcacgcctggcaggtacaacaggacccgctgcgctggggctggccggcctggccg
aaggcctttcaggatatcgacagcccggaagtgaaagccttctgcgttgagcatgaggat
gacgtcagtttctatctttggctgcagtggctggcctggagtcagtttgccgcctgctgg
gaaaccagccagcgtgacggcatgccgatcggcctctaccgcgacctggcggtgggcgtc
gccgagggcgggtcggaaacctggtgcgatcgtgaactgtactgcctgaaagcatccgta
ggcgcgccgccggatattctgggcccgctgggccagaactggggcctgccgccgatggat
ccgcatatcattgccgcccgcgcctatgagccgtttatcgacctgctgcgcgctaatatg
cagaactgcggcgcgttgcgcatcgatcacgtgatgtctgtgctgcgtctgtggtggatc
ccgtatggtgaaaccgccgaccatggcgcttacgttcagtatccggtcgacgatctgctg
tcgcttctggcgctggaaagccagcgtcatcgctgcatggtgatcggtgaagatctgggc
acggtaccggtggagatcgtcagcaagttacgcaacagcggcgtctattcttataaggtg
ctctattttgagagtgatgcagagaaaacgttccgcgcgccggcgctgtacccggagcaa
tcaatggctgtggcgacgacgcacgacctgcccactctccgcggctactgggaaagcggc
gatctgacgttaggtaaagcgctgggcctctatcctgatgaggtggtgctgcgcggactg
taccaggaccgcgagctggcgaaacaaggactgctggacgcgctgcataagtacggctgt
ctgcccaagcgcgccggccataaggcctcgctgatgagcatgacggggatcctcaaccgg
gggatgcagcgttatattgccgacagcaacagcgccctgctgggcctgcagccggaagac
tggctggagatggcgacgccggttaacattccgggcaccagcaccgagtacccgaactgg
cgccggaagctgtccgtcaccctggagcagatgtttgccgatgaacgggtcaataagctg
attaaggatctggataaacggcgcaaggccgcgagcaagaaagccgcctcctga

DBGET integrated database retrieval system