KEGG   Klebsiella pneumoniae JM45: N559_0914Help
Entry
N559_0914         CDS       T02799                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
kpj  Klebsiella pneumoniae JM45
Brite
Enzymes [BR:kpj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     N559_0914
Secretion system [BR:kpj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   N559_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
912811..913524
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYV
TDDGKHIIQGPMYDVSGAQPVNVTNQLLLGKLNALSNEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcaccctgctggcggcctccctttcaggagcggcgcac
gccgatagcgcggcaattaaacagtcgctggcgaagctgggtgtgcagagcaccgatatt
caaccatcgccggtttccgggatgagcacggtgctgaccgacagcggcgtgctgtacgtg
accgacgacggcaaacatatcatccaggggccgatgtacgacgtgagcggcgcgcagccg
gtcaacgtcaccaaccagctgctgctgggtaagctgaacgcgctgagcaatgagatgatt
gtctacaaagcgccgaaggagcagcacgtcatcaccgtcttcaccgatattacctgcggc
tactgtcataaactgcacgagcagatgagcgactacaacgcgctggggatcaccgtgcgt
tatctggccttcccgcgccaggggctgcaaagccaggccgagcaggatatgaaagcgatc
tggtgtgcgaaagatcgcaacaaagcgctggatgacgccatgaatggtaaaggcgtgcag
ccggcgagctgcagcgtagatatcgccaaacattacaccctcggcgtgcagatgggcgtc
aacggtacgccggcgatggtcctcagtaacggcatggtgctgccgggctatcaggggccg
aaagagctgaaggcgttccttgatgagcacaaaaaacagacaagcggtaactga

DBGET integrated database retrieval system