KEGG   Klebsiella pneumoniae JM45: N559_0976Help
Entry
N559_0976         CDS       T02799                                 

Definition
(GenBank) glycoside hydrolase family protein 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00052  Galactose metabolism
kpj00500  Starch and sucrose metabolism
kpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    N559_0976
   00500 Starch and sucrose metabolism
    N559_0976
Enzymes [BR:kpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     N559_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGT22763
Position
973703..975145
Genome map
AA seq 480 aa AA seqDB search
MKMMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHP
YSTQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKF
HGDPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAR
EGDTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAG
FSNRNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWE
SPLPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVD
NCEAMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLT
AGADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGAAALTEAGAWQLE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccag
gcgcttaatctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaac
gacccaaacggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccg
tactccacccagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcac
tgggagcatttgccggtagccctggcgccggagggcccggaggataaagacggctgcttt
tccggctcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttc
cacggcgatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgc
gacgggatccactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccac
ttccgtgacccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgc
gaaggcgataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggac
gcgggggtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttc
ttcaccctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcgggg
ttcagcaaccgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccag
cgttttattcgccatggcgaattccgggagatggataacggccacgatttctatgccccg
caaagcttctccacccccgatggccggcggatcgtgattggctggctggatatgtgggaa
tcgccgctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctg
agcctgagcgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgc
ggcgcctggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgac
aactgcgaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcag
tatggtctgcgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctg
gtgctggaacggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgacc
gccggggcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtc
aatgacggcgaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaatta
gcgttatttgcctggagcggcgcggcggcattaaccgaagccggcgcctggcagctcgaa
taa

DBGET integrated database retrieval system