KEGG   Klebsiella pneumoniae JM45: N559_1572Help
Entry
N559_1572         CDS       T02799                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00220  Arginine biosynthesis
kpj00250  Alanine, aspartate and glutamate metabolism
kpj00290  Valine, leucine and isoleucine biosynthesis
kpj01100  Metabolic pathways
kpj01110  Biosynthesis of secondary metabolites
kpj01130  Biosynthesis of antibiotics
kpj01210  2-Oxocarboxylic acid metabolism
kpj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N559_1572
   00290 Valine, leucine and isoleucine biosynthesis
    N559_1572
   00220 Arginine biosynthesis
    N559_1572
Enzymes [BR:kpj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     N559_1572
    2.6.1.66  valine---pyruvate transaminase
     N559_1572
Amino acid related enzymes [BR:kpj01007]
 Aminotransferase (transaminase)
  Class I
   N559_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGT23323
Position
complement(1584892..1586109)
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLQEIVEIARQHNLIIFADEIYDKILYDEAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
IPGGRLYEQRNRAWELINDIPGVSCVKPKGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPREDDLEMAISRFGRFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccatcgaaaaatccagcaagttagagaacgtctgttatgacatccgcggcccg
gttctgaaagaagccaaacgtcttgaagaagaaggcaataaggttctgaaactgaacatc
ggcaacccggcgccattcggcttcgaggcccctgacgagatcctcgtcgacgtcatccgc
aatttgcctaccgcccagggttactgcgattcgaaaggattgtactcggcgcgtaaagct
atcatgcagcattaccaggcccggggtatgcgcgatgtcacggtggaagacatctatatc
ggcaacggcgtgtccgagctgattgtgcaggcgatgcaggcgctgttaaacagcggcgat
gagatgctggttcccgccccggactacccgctgtggacggcggcggtgtcgctttccagc
ggcaaagcggtgcactatctgtgtgacgaatcctctgactggttcccggatctggacgac
atccgcgcaaaaatcacaccgcgcacccgcgggatcgtgatcattaaccctaacaacccc
accggcgcggtctattccaaagaattgctgcaggagatcgtggagatcgctcgtcagcat
aatctgatcattttcgccgatgaaatttacgacaagatcctctacgacgaagcccagcat
cactctattgccgccctggcgccggacctgctgacggtgacctttaacggattgtcgaaa
acctaccgcgttgccggcttccgtcagggctggatggtgttgaatggcccgaaaaaacac
gcgaagggctatatcgaagggctggagatgctggcttcaatgcgtctgtgcgccaacgtg
ccggcccagcatgctatccagacggcgctgggcggctatcagagcatcagcgaattcatc
atccccggcggacgcctgtatgaacaacgcaaccgcgcctgggagcttatcaacgatatt
ccgggcgtctcctgcgtgaagccaaaaggcgcgctgtatatgttcccgaaaatcgatgcc
aaacgcttcaatattcatgacgaccagaaaatggtgctcgacttcctgctgcaggagaaa
gtcctgctggtgcagggcaccgcctttaactggccgtggccggatcacgtacgcatcgtg
accctgccgcgcgaagacgacctggagatggctatctcccgctttggccgcttcctctcc
ggctaccatcagctttaa

DBGET integrated database retrieval system