KEGG   Klebsiella pneumoniae JM45: N559_2079Help
Entry
N559_2079         CDS       T02799                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    N559_2079
Enzymes [BR:kpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     N559_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2132709..2133236
Genome map
AA seq 175 aa AA seqDB search
MRTVVYTAEIDDRFGAGKVSSRIGLSSPARLYNPQTSLFDDIAAEHQLKPIHCVLVDESQ
FLTREQVHELSEVVDTLDIPVLCYGLRTDFRGELFTGSQYLLAWSDKLVELKTICFCGRK
ASMVLRLDQEGRPYNEGEQVVIGGNERYVSVCRKHYKEALSVGSLTKVQNQHRPC
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccgtcgtttataccgctgagattgatgaccgctttggcgccggaaaagtcagt
tcgcgtatcgggctctcctcgccggcccgattgtataatccacagacctcgttatttgac
gatattgcggcggagcaccagctaaagccgattcactgcgtgctggtggatgaaagccag
tttctgacgcgtgaacaggttcatgagctgtccgaagttgtcgatacgctggatattccg
gtgctttgctatgggttgcggacggactttcgcggtgagctctttaccggcagccagtat
ttactggcctggtcagataagctggttgagctgaaaacgatctgcttctgcggccgcaag
gccagcatggtattgcgcctcgatcaggaggggcgtccttataatgagggtgagcaggtc
gtcatcggcggtaatgagcggtacgtatcggtctgccgtaagcattataaagaggcgctg
agcgtcggttcgttaaccaaggtacaaaaccagcaccgtccctgctga

DBGET integrated database retrieval system