KEGG   Klebsiella pneumoniae JM45: N559_2172Help
Entry
N559_2172         CDS       T02799                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    N559_2172
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N559_2172
   00650 Butanoate metabolism
    N559_2172
  Amino acid metabolism
   00360 Phenylalanine metabolism
    N559_2172
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N559_2172
   00622 Xylene degradation
    N559_2172
   00621 Dioxin degradation
    N559_2172
Enzymes [BR:kpj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     N559_2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2222822..2223775
Genome map
AA seq 317 aa AA seqDB search
MMRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRLGVATTHEGV
GGLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLAA
NLHQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTS
QAIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYVLSELASQEAIAASIAEMAAAVQAYVPG
YRLKQQVQFEVIPEDRPVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALA
TAEQMAGAMHSAAGATA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatg
attaaaatcctgcgccacggccagcatctggagatggcggtgatggtcggcatcgacccg
cagtcggatggcctggcccgcgccaggcgcctgggcgttgcgaccactcacgaaggggtg
ggcggcctgatgcagatggcggaatttgccgacatcgattttgtttttgacgccaccagc
gccggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgtt
atcgacctgacgccggcggcgattggcccatactgcgtaccggtggtcaacctcgcggcc
aatctccatcagggcaacgtcaatatggtgacctgcggcgggcaggcgaccatcccaatg
gtcgccgcggtctcgcgagtggcgaaggtgcattacgcggagatcgtggcctcgatcgcc
agccaatccgccgggccgggcacgcgggccaatattgacgaatttaccgaaaccacctcg
caggcgattgaaaaagtcggcggcgcgggcaagggcaaagcgattattgtactgaacccg
gcggagccgccgctgatgatgcgcgataccgtctacgtcctgagcgagctggcgtcgcag
gaggcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggcttacgtcccgggc
taccggctgaagcagcaggtgcagtttgaggttatccccgaggacaggccggtcaacctg
cccggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaagtggaaggggcg
gcgcactatctgccagcgtacgcgggcaacctcgatattatgacctcggcggcgctggcg
acggcggagcaaatggccggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system