KEGG   Klebsiella pneumoniae JM45: N559_2611Help
Entry
N559_2611         CDS       T02799                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00071  Fatty acid degradation
kpj00072  Synthesis and degradation of ketone bodies
kpj00280  Valine, leucine and isoleucine degradation
kpj00310  Lysine degradation
kpj00362  Benzoate degradation
kpj00380  Tryptophan metabolism
kpj00620  Pyruvate metabolism
kpj00630  Glyoxylate and dicarboxylate metabolism
kpj00640  Propanoate metabolism
kpj00650  Butanoate metabolism
kpj00900  Terpenoid backbone biosynthesis
kpj01100  Metabolic pathways
kpj01110  Biosynthesis of secondary metabolites
kpj01120  Microbial metabolism in diverse environments
kpj01130  Biosynthesis of antibiotics
kpj01200  Carbon metabolism
kpj01212  Fatty acid metabolism
kpj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N559_2611
   00630 Glyoxylate and dicarboxylate metabolism
    N559_2611
   00640 Propanoate metabolism
    N559_2611
   00650 Butanoate metabolism
    N559_2611
  Lipid metabolism
   00071 Fatty acid degradation
    N559_2611
   00072 Synthesis and degradation of ketone bodies
    N559_2611
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N559_2611
   00310 Lysine degradation
    N559_2611
   00380 Tryptophan metabolism
    N559_2611
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N559_2611
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N559_2611
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N559_2611
Enzymes [BR:kpj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N559_2611
Exosome [BR:kpj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N559_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGT24287
Position
2665627..2666817
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRDTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgccaactgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgtggttccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccatggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttt
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggagggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcgacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggggcggagattatggggtttggtccctctcccgccacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaatgaggct
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtctcgacccggcccgcgttaac
gtcaacggcggcgcgatcgctctcggccacccggtaggcgccagcggtgcgatcctgcct
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system