KEGG   Klebsiella pneumoniae JM45: N559_2674Help
Entry
N559_2674         CDS       T02799                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N559_2674
   00330 Arginine and proline metabolism
    N559_2674
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    N559_2674
Enzymes [BR:kpj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     N559_2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2725203..2726150)
Genome map
AA seq 315 aa AA seqDB search
MVGKEPRVATVINNAMLEAILAEIRPLIGRGKVADYIPALASVSGDKLGIAISTVDGQHF
AAGDAHERFSIQSISKVLSLVVAMNHYQEEEIWQRVGKDPSGQPFNSLLQLEIEQGKPRN
PFINAGALVVCDMLQSRLSAPRQRMLEIVRRLSGVADIAYDPVVARSEFEHSARNAAIGW
LMKSFGNFHNDVATVLQNYFHYCSLEMSCVELARTFLFLADRGIAPHLDAPVIAPIQSRQ
VNALMMTSGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPQEMAIAVWSPELDDAGNSLAGV
AILEKLTQRMGRSVF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcaaggagccgcgtgtggcgacggttatcaataatgcaatgctggaagccatt
ctggcagaaatcaggccgctgattggccgcggaaaagtggcggattatattccggcgctg
gccagcgtcagcggcgacaagcttggtatcgcgatcagtacggtggacggtcagcacttt
gccgctggcgatgcccatgaacgtttttccatccagtcaatctccaaggtattgagcctg
gtggttgccatgaaccactatcaggaggaggagatctggcagcgggtggggaaagatcct
tccggccagccctttaactcgcttctgcagctggagatcgagcagggcaaaccgcgcaac
ccgtttatcaacgccggggcactggtggtctgcgacatgctgcagagccggctcagcgcc
ccgcgtcagcggatgctggagattgtccgccgtctgagcggcgtggccgatatcgcctac
gatccggtggtggctcgctcagagtttgagcattcggcgcgcaacgccgccatcggctgg
ctgatgaaatcctttggtaacttccataacgacgtcgccaccgtgctgcagaactatttc
cactactgttcgctggagatgagctgcgttgagctggcgcgaacctttctgtttctcgcc
gaccgcggcattgccccgcatctcgacgcgccggttattgcgcccatccagtcccgccag
gttaatgccctgatgatgaccagcggcatgtaccagaacgccggtgaattcgcctggcgc
gttggcctgccggcgaaatcgggcgtcggcggcgggatcgtggcgattgtcccgcaggag
atggcgatcgccgtgtggagcccggagcttgacgacgccgggaactcgctggccggcgtg
gcgatactggaaaaactgactcagcggatggggaggtcggtgttctga

DBGET integrated database retrieval system