KEGG   Klebsiella pneumoniae JM45: N559_3592Help
Entry
N559_3592         CDS       T02799                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00020  Citrate cycle (TCA cycle)
kpj00310  Lysine degradation
kpj00380  Tryptophan metabolism
kpj01100  Metabolic pathways
kpj01110  Biosynthesis of secondary metabolites
kpj01120  Microbial metabolism in diverse environments
kpj01130  Biosynthesis of antibiotics
kpj01200  Carbon metabolism
Module
kpj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N559_3592
  Amino acid metabolism
   00310 Lysine degradation
    N559_3592
   00380 Tryptophan metabolism
    N559_3592
Enzymes [BR:kpj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     N559_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AGT25239
Position
complement(3649728..3652535)
Genome map
AA seq 935 aa AA seqDB search
MQNGAMKAWLDSSYLSGSNQSWIEQLYEDFLTDPDSVDANWRSMFQQLPGTGVKPDQFHS
KTRDYFRRLAKDASRYTSSISDPDTNVKQVKVLQLINAYRFRGHQHANLDPLGLWKQERV
ADLDPAYHDLTEADFQESYNVGSFAIGKDTMKLGELIVALKQTYCGSIGAEYMHITSTEE
KRWIQQRIESVAGKASFTPEEKKRFLSELTAAEGLERYLGAKFPGAKRFSLEGGDALIPM
LKEMIRHAGKSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDEFAGKHKEHLGTGDVKYH
MGFSSDMETEGGLVHLALAFNPSHLEIVSPVVIGSVRARLDRLDEPSSNKVLPITIHGDA
AVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVQAP
IFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQPLMYQKIK
KHPTPRKIYADKLEQEKVATLEDATEQVNLYRDALDAGECVVQEWRPMNMHSFTWSPYLN
HEWDESYPDKVEPKRLQELAKRISTVPEGIEMQSRVAKIYADRQAMAAGEKLFDWGGAEN
LAYATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQTNGSTYTPLQHVHNGQGQFRVWDSV
LSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLL
PHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSP
KSLLRHPLAVSSMDELANGTFLPAIGEIDQLDPQAVKRVVLCSGKVYYDLLEQRRKNEQK
DVAIVRIEQLYPFPHQAVQEALKAYAHVHDFVWCQEEPLNQGAWYCSQHHFREVIPFGAS
LRYAGRPASASPAVGYMSVHQKQQQDLVNDALNVD
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacggcgcaatgaaagcctggctggactcttcttacctctctggttcgaaccag
agctggatagaacagctctatgaagacttcttaaccgatcctgactctgttgacgccaac
tggcgttcaatgttccagcagttacctggcaccggagttaaaccggatcaatttcattcc
aaaacgcgtgattatttccgtcgactggcgaaggatgcctcacgttacacttcttcgatt
tccgacccagacactaatgtgaagcaggttaaagtcctgcagctcatcaacgcataccgt
ttccgtggccaccagcatgcgaatctcgatccgctggggctgtggaagcaagagagagtg
gcggatctcgatccggcctaccacgatctgaccgaggccgatttccaggaaagctataac
gtaggttcatttgccatcggtaaagacacgatgaagctgggcgagctgattgtcgccctc
aagcaaacctactgcggctccatcggcgcggaatacatgcatatcacctctaccgaagaa
aaacgctggatccagcagcgcattgaatcggtagctggcaaagcgagctttaccccggaa
gagaaaaaacgcttcctcagcgaactgaccgccgcggaaggtctggagcgctacctcggc
gccaaattcccgggggcgaagcgcttctcgctggagggtggcgacgccctgatcccgatg
ctcaaagagatgatccgccatgcaggcaaaagcggcacccgcgaagtggtgctgggcatg
gcgcaccgcggccgtctgaacgtgctggtcaacgtgctgggtaaaaaaccgcaggacctg
ttcgacgagttcgcgggcaaacataaagaacacctcggcaccggcgacgtgaagtaccac
atgggcttctcttccgatatggaaaccgaaggcggtctggtgcacctggcgctggcgttt
aacccgtcgcacctcgagatcgtcagcccggtggttatcggttccgtacgcgcccgtctg
gatcgtctggacgagccaagcagcaacaaagttctgcctattaccatccacggcgacgcc
gccgtcaccggccagggcgtggttcaggaaactctgaacatgtccaaagcccgcggttac
gaagtgggcggtaccgtgcgcatcgttatcaacaaccaagtgggcttcacgacctctaac
ccgctggatgcgcgctcgacgccgtactgcaccgacatcggtaaaatggtgcaggcgccg
attttccacgtcaatgcggacgatccggaagcggtcgccttcgtcacccgtctggcgctt
gatttccgcaatacctttaaacgcgatgtcttcattgatctggtgtgctaccgccgtcac
ggccacaacgaagccgatgagccgagcgcaacccagccgctgatgtatcagaagatcaaa
aagcatccgactccgcgcaaaatctatgctgacaagctggagcaggagaaggtggcgact
ctggaagatgcgaccgagcaggttaacctctatcgcgatgcgctggatgccggcgaatgc
gtggtgcaggaatggcgtccgatgaatatgcattcctttacctggtcgccgtacctcaac
cacgagtgggacgagagctatccggataaagttgagccgaaacgtctgcaggagttggcc
aaacgcatcagcacggtaccggaaggtatcgaaatgcagtcccgcgtggcgaaaatttac
gccgaccgccaggcgatggcggcaggcgagaagctgtttgactggggcggcgccgaaaac
ctggcctacgccacgctggttgacgaaggtattccggttcgtctgtccggcgaagactcc
ggccgcggcaccttcttccaccgtcatgcggtgatccataaccagaccaatggttcaacc
tacacgccgctgcagcatgtccataacggccagggccagttccgcgtttgggactcggta
ctgtctgaagaagcggtgctggcgttcgaatatggctacgccaccgccgagccgcgcact
ctgaccatctgggaagcgcagtttggcgacttcgccaacggcgcgcaggtggtgatcgac
cagttcatctcctccggtgagcagaaatggggaaggatgtgcggcctggtgatgctcctg
ccgcacggttacgaaggccagggcccggagcactcctccgcgcgtctggagcgttatctg
cagctgtgcgctgaacaaaacatgcaggtctgcgtgccgtccacgccggcacaggtttat
cacatgctgcgtcgccaggcgctgcgcggtatgcgtcgtccgctggtggtgatgtcgccg
aagtcgctgctgcgtcatccgctggcggtctccagcatggatgagctggcgaacggcact
ttcctgccggctattggtgaaatcgatcaacttgatccgcaggctgtgaagcgcgttgtg
ctgtgctctggtaaggtttactacgacctgctggaacagcgccgcaaaaacgagcaaaaa
gatgtcgctatcgttcgtatcgagcagctctatccgttcccgcatcaggcggtgcaggaa
gcgctgaaagcgtatgcgcacgtgcatgattttgtctggtgccaggaagagccgctcaac
cagggcgcatggtactgcagccagcatcacttccgtgaagtgattccgtttggggcctct
ctgcgttatgcaggccgcccggcctccgcctctccggcggtagggtatatgtccgttcac
cagaaacagcaacaagatctggtcaatgacgcgctgaacgtcgattaa

DBGET integrated database retrieval system