KEGG   Klebsiella pneumoniae JM45: N559_4085Help
Entry
N559_4085         CDS       T02799                                 

Definition
alkaline phosphatase H
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    N559_4085
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    N559_4085
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N559_4085
Enzymes [BR:kpj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     N559_4085
Exosome [BR:kpj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N559_4085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4153451..4154881)
Genome map
AA seq 476 aa AA seqDB search
MEMTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEAL
RASLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKA
SYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTH
DGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaaaagtgaaattaagcgccctgtttattgccctgattcctctactgggc
tcgccggttattcatgcagaaactactgctgcgccggttctggaaaatcgcgctgcgcag
ggagatatcaccactcctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctg
cgcgcctcgttaatcaataagccagctaaaaacgttattttgctgattggcgatggcatg
ggtgattcggaaattaccgctgcgcgaaactatgccgagggggcgggcggtttctttaaa
ggaattgatgctctgccgttaaccgggcagtacacgcattattcgctggataaaaaaacc
gggaaaccggactacgtgaccgactcggcggcctccgccaccgcctggaccaccggcgtg
aagacttataacggcgcgctgggcgtcgatattcatgagaatgcgcatcagaccatcctc
gagctggcgaaagcggcggggctggccaccggcaacgtttccaccgccgagctgcaggac
gccacccccgcggcgttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggtc
accagcgaaaaatgccccagcaatgcgctggaaaaagggggcaaaggctccattaccgaa
cagctgctgaacgcccgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaa
acggcgacggcgggcgagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggc
taccagattgtgaccgacgcggcttctcttgccgccgcgacggaagccagtcaggataaa
ccgctgctgggactctttgccgatggcaatatgccggtacgctgggaagggccgaaggcg
tcttatcacggtaatatcgataagccgccggtgacctgtacgccaaacccgaagcgtgac
gcctcggtgccgacgctggcgcaaatgacggagaaagcgattgacctgctgagtcgcaac
gagaaaggtttcttcctgcaagtcgaaggcgcttccatcgataagcaggaccatgcggcc
aatccgtgcggccagatcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctg
gaattcgcgcgaaaagacggtaataccctggtgatcgtcaccgccgaccatgcgcatgcc
agccagatcatcccggcggatagcaaagccccggggctgacccaggctctgaacacgcac
gatggcgcggtgatggtgatgagctacggcaactctgaggaagagtcgatggagcacacc
ggcacccaactgcgcattgcggcctacggtccgcatgcggctaacgtcgtcggcctgacc
gatcagaccgacctgttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system