KEGG   Klebsiella pneumoniae JM45: N559_4134Help
Entry
N559_4134         CDS       T02799                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    N559_4134
  Amino acid metabolism
   00330 Arginine and proline metabolism
    N559_4134
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    N559_4134
Enzymes [BR:kpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     N559_4134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4202473..4203576
Genome map
AA seq 367 aa AA seqDB search
MSESQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAMGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNSIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQPGLFTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGNRPD
VIGHAMAGLPVGTCFHAQESPLENRKRWIFGAPPAGEITVDAGATQAILERGSSLLPKGI
KIVSGNFSRGEVIRIRNSEGRDIAHGVSRYNSDALRLIAGQHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagccagacgctggtggtaaaactgggcaccagtgttttaacaggcgggtcc
cgtcgcctgaaccgcgcccatatcgtcgagcttgtgcgccagtgcgcacagttgcacgcc
atgggacaccgtattgtcatcgtgacctccggggccattgccgccgggcgcgagcacctt
ggttacccggaactgcccgccaccatcgcctccaagcagctgctggcggcggtgggacaa
agccgtctgatccagctgtgggaacagctgttttctatctatggcattcacgttggccag
atgctgctgacccgcgccgacatggaagacagagaacggttcctcaacgcccgcgacact
ctgcgtgcgctgctggataacagcatcgtcccggtcattaacgaaaacgacgccgtcgct
accgcggaaatcaaagtgggcgataacgacaatctctccgcgctggccgcgatcctcgcc
ggggcggataagctgctgctgttaaccgaccagccaggcctgttcaccgccgacccgcgc
agcaacccgcaggcggagctgattaaagacgtttacggcatcgacgacgcgctgcgcgcc
atcgccggcgatagcgtctccggacttggcaccggcggcatgggcaccaagctgcaggcc
gcggacgtcgcctgccgggcggggattgataccatcatcgccgccgggaaccgtccggac
gtcatcggccatgcgatggcaggcctgccggtaggtacctgcttccacgcccaggagtct
ccgctggagaaccgtaagcgctggatcttcggcgcgccgccggcgggggaaatcaccgtc
gatgcgggcgcgacccaggcgatcctcgaaagaggcagctcgctattgccaaaaggcatc
aaaatcgtcagcggcaacttctcccgcggcgaagtgatccgcatccgcaatagcgaagga
cgcgacatcgctcacggcgtcagccgctacaacagcgatgcgctgcgccttatcgccggc
cagcactcgcagcaaatcgatgccattctgggctatgaatacggcccggtggccgtccac
cgcgatgatatgatcatccgttaa

DBGET integrated database retrieval system