KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_00440Help
Entry
KPHS_00440        CDS       T01733                                 

Definition
putative 6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:kpm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:kpm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kpm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:kpm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
51011..51991
Genome map
AA seq 326 aa AA seqDB search
MKIGIVISGGDVSGMNNFIFQIARQANADITLFNGGIPGLLEKSHQDMAWRDLVDYSITA
VPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMAGGDGSLQFLNTLSEFEINCFGVGM
TIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRALPGRVFMVEILGGYCGELTLQSAIK
CNADIALIPEAQMPLAVLAERITRKLSTQNSVVILCSEGYTKEYSPGFQGAIDTMIKQLE
PQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEVVRCIQSGMKNKAIIINSSNKPIPI
DLVSMKKRLVDTEGHHYKLAKQLNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtatcgttattagcggcggggatgtttctggaatgaataattttatattc
cagatagccaggcaggctaatgctgatatcacgctgtttaatggcggtattccagggcta
ctggagaaaagtcatcaggatatggcgtggcgcgatctggttgattattcaattaccgcg
gtgccgatcattacctcggggcgaaccagtcgcaaactgcagcgcagtgaatatgaaagc
attgctaaaaaacttaaatctctgcgtattgatgtgctcattatggccgggggggatggc
agcctgcagtttctgaatacccttagtgaatttgagattaattgctttggtgtgggaatg
actatcgataatgatgtgtatggcagtgattatacgattggtttttccacggcctgtgag
caaattattaaagaagtctctcgtttaagaaataccggaagagcgctgcccggtcgggtt
tttatggttgagatattaggaggctattgtggagaactaacgttgcagtccgccattaaa
tgtaatgcggatattgccctgatcccggaggcacagatgccgttggccgtgctcgcggaa
cggattacccggaagctgagtacgcagaatagcgtcgttatcctctgctcagaaggctat
accaaagagtactctcccggctttcagggggcgattgataccatgattaaacagctggaa
ccacaaataggtgtccgtatccgtaaaacgatcgtcggctatggtttacgcagcggtgat
ccaacctgcgaagagatttatcagggcactattatggccagtgaagtggttcgctgtatt
cagtcaggtatgaaaaataaagccataataattaattccagtaacaaacctattccgatt
gatttagtcagtatgaaaaaacgtctggtcgatactgaaggacatcattataaacttgcc
aagcaactcaatattatttga

DBGET integrated database retrieval system