KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_00750Help
Entry
KPHS_00750        CDS       T01733                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00030  Pentose phosphate pathway
kpm00051  Fructose and mannose metabolism
kpm00052  Galactose metabolism
kpm00680  Methane metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
kpm01230  Biosynthesis of amino acids
kpm03018  RNA degradation
Module
kpm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_00750
   00030 Pentose phosphate pathway
    KPHS_00750
   00051 Fructose and mannose metabolism
    KPHS_00750
   00052 Galactose metabolism
    KPHS_00750
  Energy metabolism
   00680 Methane metabolism
    KPHS_00750
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KPHS_00750
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPHS_00750
Protein phosphatases and associated proteins [BR:kpm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KPHS_00750
Messenger RNA biogenesis [BR:kpm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KPHS_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 11845053
NCBI-ProteinID: YP_005224375
UniProt: A0A0H3GGY4
Position
80983..81945
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFIMVPEVEYTRDDLVAEIKAGIAKGKKHAIVAITEHMCDVDELASYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKNDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgcgccgggcatgaacgcagca
attcgtggcgttgtgcgcgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggattgtatgaagaccgtatggttcagctcgaccgttacagcgtttccgac
atgatcaaccgcggcggtaccttcctgggctccgctcgcttcccggaattccgcgaagaa
cacatccgcgctgtggctatcgaaaacatgaagaagcgcggcctggacgcgctggtggtt
atcggcggtgacggttcctatatgggggcgatgcgcctgaccgagatgggcttcccatgc
atcggcctgccgggcactatcgacaacgatatcaaaggcactgactacaccatcggcttc
tttactgccctgagcaccgtggtggaagcgattgaccgtttgcgcgacacctcctcttcg
caccagcgtatctccgtggtggaagtgatgggccgttactgtggcgacctgaccctggcg
gcggcgattgccggcggctgtgagttcatcatggtgcctgaagtggaatatacccgtgac
gatctggtggcagaaatcaaagccggtatcgcgaaagggaaaaaacacgctatcgtggcc
atcaccgagcacatgtgcgacgttgacgagctggcaagctacatcgagaaagagactggc
cgtgaaactcgcgccaccgtcctcggccacattcagcgcggcggttccccggttccttac
gaccgcatcctggcttcccgcatgggcgcctatgcgattgagctgctgctgcagggccat
ggcggccgttgcgtcggcatccagaacgagaagctggtgcaccacgacataatcgatgcc
atcgagaacatgaagcgtccgttcaagaacgactggctggattgcgcgaagaaactgtac
taa

DBGET integrated database retrieval system