KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_00750Help
Entry
KPHS_00750        CDS       T01733                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:kpm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:kpm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kpm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:kpm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80983..81945
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFIMVPEVEYTRDDLVAEIKAGIAKGKKHAIVAITEHMCDVDELASYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKNDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgcgccgggcatgaacgcagca
attcgtggcgttgtgcgcgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggattgtatgaagaccgtatggttcagctcgaccgttacagcgtttccgac
atgatcaaccgcggcggtaccttcctgggctccgctcgcttcccggaattccgcgaagaa
cacatccgcgctgtggctatcgaaaacatgaagaagcgcggcctggacgcgctggtggtt
atcggcggtgacggttcctatatgggggcgatgcgcctgaccgagatgggcttcccatgc
atcggcctgccgggcactatcgacaacgatatcaaaggcactgactacaccatcggcttc
tttactgccctgagcaccgtggtggaagcgattgaccgtttgcgcgacacctcctcttcg
caccagcgtatctccgtggtggaagtgatgggccgttactgtggcgacctgaccctggcg
gcggcgattgccggcggctgtgagttcatcatggtgcctgaagtggaatatacccgtgac
gatctggtggcagaaatcaaagccggtatcgcgaaagggaaaaaacacgctatcgtggcc
atcaccgagcacatgtgcgacgttgacgagctggcaagctacatcgagaaagagactggc
cgtgaaactcgcgccaccgtcctcggccacattcagcgcggcggttccccggttccttac
gaccgcatcctggcttcccgcatgggcgcctatgcgattgagctgctgctgcagggccat
ggcggccgttgcgtcggcatccagaacgagaagctggtgcaccacgacataatcgatgcc
atcgagaacatgaagcgtccgttcaagaacgactggctggattgcgcgaagaaactgtac
taa

DBGET integrated database retrieval system